Detailed description page of ThPDB2

This page displays user query in tabular form.

Th1023 details
Primary information
ID10180
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeHealthy subjects = 4 - 6 hours
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberCA2141953
Date of Issue8-Apr-2008
Date of Expiry17-Sep-2013
Drug InteractionCanakinumab results in increased immunosuppressive effects; increases the risk of infection.
TargetInterleukin-1 receptor type 1
Brand NameKineret
CompanyAmgen Inc
Brand DescriptionAmgen Inc
Prescribed ForTo treat the symptoms of moderate to severe rheumatoid arthritis in adults. Anakinra may also help slow the progress of the disease.
Chemical NameNA
FormulationThe solution may contain trace amounts of small, translucent-to-white amorphous proteinaceous particles. Each prefilled glass syringe contains: 0.67 mL (100 mg) of anakinra in a solution (pH 6.5) containing disodium EDTA (0.12 mg), sodium chloride (5.48 m
Physical Appearance Sterile, clear, colorless-to-white, preservative free solution
Route of AdministrationSubcutaneous (Subcutaneous) administration
Recommended Dosage100 mg/day administered daily
ContraindicationContraindicated in patients with known hypersensitivity to E coli-derived proteins, Kineret, or any components of the product
Side EffectsNausea, diarrhea, stomach pain; headache; cold symptoms such as stuffy nose, sneezing, sore throat; or redness, bruising, pain, or swelling where the injection was given.
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID10181
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNOMID patients = 5.7 hours (range of 3.1 - 28.2 hours)
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberCA1341322
Date of Issue27-Nov-2001
Date of Expiry27-Nov-2018
Drug InteractionCertolizumab pegol Co-administration with other TNF-blocking agents may increase the risk of serious infections. Concomitant therapy is not recommended.
TargetNA
Brand NameNA
CompanyBioVitrum AB
Brand DescriptionBioVitrum AB
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID10182
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNA
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionTrastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2NA
RemarksNA


Primary information
ID10183
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNA
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionGolimumab. Avoid combination with anakinra due to the increased chance of serious infection.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA


Primary information
ID10184
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNA
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionRilonacept results in increased immunosuppressive effects; increases the risk of infection.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA


Primary information
ID10185
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNA
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionTofacitinib. Avoid combination due to the potential increase in tofacitinib related adverse effects.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA


Primary information
ID10186
Therapeutic IDTh1023
Protein NameAnakinra
Sequence>Th1023_Anakinra MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular Weight17257.6
Chemical FormulaC759H1186N208O232S10
Isoelectric Point5.46
Hydrophobicity-0.412
Melting pointNA
Half-lifeNA
DescriptionAnakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.
Indication/DiseaseTo treat adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
PharmacodynamicsAnakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
Mechanism of ActionAnakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
ToxicityMost common adverse reactions (incidence 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used
MetabolismAs a protein-based therapy, anakinra is expected to be metabolized by proteases throughout the body.
AbsorptionWhen a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once dail
18.5 L
ClearanceClearance is variable and increases with increasing creatinine clearance and body weight.
CategoriesAgents reducing cytokine levels, Amino Acids, Peptides, and Proteins, Antineoplastic and Immunomodulating Agents, Antirheumatic Agents, Biological Factors, Biologics for Rheumatoid Arthritis Treatment, Cytokines, Disease-modifying Antirheumatic Agents, Immunosuppressive Agents, Immunotherapy, Intercellular Signaling Peptides and Proteins, Interleukin Inhibitors, Interleukin-1 Receptor Antagonist, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionThalidomide may increase the adverse effects of Anakinra. Increased risk of serious infection. Concomitant therapy should be avoided.
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA