Detailed description page of ThPDB2
| This page displays user query in tabular form. |
Th1014 details |
| Primary information | |
|---|---|
| ID | 10098 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | US6440392 |
| Date of Issue | 27-Aug-2002 |
| Date of Expiry | 2-Feb-2021 |
| Drug Interaction | Eskalith (lithium) |
| Target | Calcitonin receptor |
| Brand Name | Calcimar |
| Company | Sanofi Aventis |
| Brand Description | Sanofi Aventis |
| Prescribed For | To treat Paget's disease of bone |
| Chemical Name | NA |
| Formulation | Each mL of sterile solution contains calcitonin salmon 200 IU. Nonmedicinal ingredients include acetic acid, phenol, sodium acetate, sodium chloride, sodium hydroxide and water for injection. |
| Physical Appearance | Solution |
| Route of Administration | Subcutaneous or intramuSubcutaneousular Injection |
| Recommended Dosage | Based on body weight and injected every 12 hours |
| Contraindication | Allergy |
| Side Effects | Feeling light-headed, fainting; or muscle stiffness. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10099 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | US5733569 |
| Date of Issue | 31-Mar-1998 |
| Date of Expiry | 31-Mar-2015 |
| Drug Interaction | Eskalith-CR (lithium) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | For treatment of postmenopausal osteoporosis |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Swelling in your feet |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10100 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Foscavir (foscarnet) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | To reduce high levels of calcium in the blood (hypercalcemia) |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Swelling or irritation of the skin where an injection was given. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10101 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Lithium Carbonate ER (lithium) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Warmth, redness, itching, or tingly feeling under your skin; nausea, loss of appetite, stomach pain |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10102 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Lithobid (lithium) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Vomiting; skin rash or itching; increased urination, especially at night; eye pain |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10103 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Lithonate (lithium) |
| Target | NA |
| Brand Name | Fortical |
| Company | Upsher-Smith Laboratories, Inc., Physicians Total Care, Inc. |
| Brand Description | Upsher-Smith Laboratories, Inc., Physicians Total Care, Inc. |
| Prescribed For | Used to treat osteoporosis in women who have been in menopause for at least 5 years. To be used along with adequate calcium and vitamin D intake. |
| Chemical Name | NA |
| Formulation | Calcitonin-salmon 2200 International Units/mL, corresponding to 200 International Units per actuation (0.09 mL) and Sodium Chloride, Citric Acid, Phenylethyl Alcohol, Benzyl Alcohol, Polysorbate 80, Hydrochloric Acid or Sodium Hydroxide (added as necess |
| Physical Appearance | Nasal spray |
| Route of Administration | Intranasal use |
| Recommended Dosage | Each spray delivers 200 International Units calcitonin-salmon in a volume of 0.09 mL. |
| Contraindication | Allergy |
| Side Effects | Tremors or shaking, feeling like you might pass out, severe nasal irritation. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10104 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Lithotabs (lithium) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose, crusting, scabs, or sores inside your nose, redness in or around your nose. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10105 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10106 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Miacalcin |
| Company | Novartis, Mylan Institutional LLC, Physicians Total Care, Inc., Sebela Pharmaceuticals Inc. |
| Brand Description | Novartis, Mylan Institutional LLC, Physicians Total Care, Inc., Sebela Pharmaceuticals Inc. |
| Prescribed For | Miacalcin Nasal Spray is used to treat osteoporosis in women who have been in menopause for at least 5 years. To be supplemented with adequate calcium and vitamin D intake. |
| Chemical Name | NA |
| Formulation | Each milliliter contains calcitonin-salmon 200 I.U., acetic acid, USP, 2.25 mg; phenol, USP, 5.0 mg; sodium acetate trihydrate, USP, 2.0 mg; sodium chloride, USP, 7.5 mg; water for injection, USP, qs to 1.0 mL |
| Physical Appearance | Solution |
| Route of Administration | Subcutaneous or intramuSubcutaneousular Injection |
| Recommended Dosage | For treatment of symptomatic Paget's disease of bone, 100 International Units (0.5 mL) per day administered subcutaneously or intramuscularly and for early treatment of hypercalcemia, 4 International Units/kg body weight every 12 hours by subcutaneous or |
| Contraindication | Allergic, nasal or sinus problem such as nasal deformities, a chronic infection, or nasal pain. |
| Side Effects | Tremors or shaking, feeling like you might pass out, severe nasal irritation. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10107 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Bleeding from your nose, runny or stuffy nose, dryness, itching, tenderness, or general discomfort of your nose. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10108 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Crusting, scabs, or sores inside your nose, redness in or around your nose. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |
| Primary information | |
|---|---|
| ID | 10109 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg | |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Warmth, redness, or tingly feeling under your skin, headache, back pain, nausea. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |