|
| Primary information |
|---|
| ID | 16236 |
| Therapeutic ID | Th1749 |
| Protein Name | ABX-PTH |
| Sequence | >Th1749_ABX-PTH
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | ABX-PTH is a fully human monoclonal antibody generated by Abgenix's technology platform. This drug targets and neutralizes the action of parathyroid hormone (PTH) for the treatment of a secondary hyperparathyroidism. |
| Indication/Disease | Investigated for use/treatment in chronic renal failure and parathyroid disorders. |
| Pharmacodynamics | NA |
| Mechanism of Action | ABX-PTH is being developed for the treatment of secondary hyperparathyroidism (SHPT). SHPT is a chronic disorder that is frequently observed in patients with chronic kidney disease. Preclinical studies demonstrate ABX-PTH to be highly potent in vivo models of SHPT. ABX-PTH takes a novel approach to addressing secondary hyperparathyroidism (SHPT), because it directly lowers serum levels of free parathyroid hormone. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Parathyroid hormone |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |