| Primary information |
|---|
| ID | 15982 |
| Therapeutic ID | Th1659 |
| Protein Name | Casirivimab |
| Sequence | >Th1659_Casirivimab
QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYITYSGSTIYYADSVKGRFTISRDNAKSSLYLQMNSLRAEDTAVYYCARDRGTTMVPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Casirivimab is a monoclonal antibody combined with [Imdevimab] in Regeneron's antibody cocktail known as REGN-COV2 for the treatment of COVID-19.[L23539] This drug is a combination of antibodies derived from humanized VelocImmune® mice in addition to blood samples from patients who have recovered from COVID-19.[A224429] These antibodies have been formulated to bind to multiple locations on the SARS-COV-2 spike protein, preventing viral escape.[A221495] On November 21 2020, the FDA authorized emergency approval of REGEN-COV2 to treat mild to moderate COVID-19 in patients aged 12 years and older. Casirivimab and imdevimab are investigational recombinant human IgG1 monoclonal antibodies that, at this time, are not officially approved by the FDA. They are reserved for Emergency Use Authorization (EUA) only.[L23524] In November 2021, the same indication was approved by the EMA.[L39130,L39135] Full safety and efficacy data are not yet available, and further evaluation of this investigational therapy will continue.[L23539,L23529,L14303] |
| Indication/Disease | According to the Emergency Use Authorization (EUA) by the FDA and EMA, indevimab is used only with casirivimab to prevent COVID-19 and treat mild to moderate COVID-19 from laboratory-confirmed SARS-CoV-2 infection in patients aged 12 years of age and older who weigh at least 40 kg. Treatment is reserved for patients who are at high risk for progressing to require hospitalization or severe COVID-19.[L23524,L23534,L39135] This combination may only be administered by intravenous infusion in healthcare settings with immediate access to treatment for infusion reactions and anaphylaxis, and the ability to activate the emergency medical system (EMS), as required.[L23539,L23534] **Limitations of use** Imdevimab and casirivimab are not for use in patients currently hospitalized due to COVID-19, patients requiring oxygen therapy due to COVID-19, patients requiring increases in baseline oxygen flow rate from COVID-19, or patients on oxygen therapy for non-COVID-19 related morbidity.[L23524,L23534] |
| Pharmacodynamics | Casirivimab and imdevimab work to neutralize the spike protein of SARS-CoV-2.[L23524] In a clinical trial, casirivimab and imdevimab, when given together, reduced COVID-19-related hospitalization or emergency room visits in patients diagnosed with COVID-19 who were at high risk for disease progression within 28 days after treatment. No benefit has been shown in patients already hospitalized due to COVID-19 receiving this combination.[L23539] |
| Mechanism of Action | Casirivimab is a recombinant human IgG1 monoclonal antibody targeting the receptor binding domain of the spike protein of SARS-CoV-2; a protein playing an important role in viral attachment, fusion, and entry into the cell.[A224434,L23529] Together with imdevimab, casirivimab neutralizes the spike protein of SARS-CoV-2.[L23529] |
| Toxicity | There is limited information on overdose. Up to 4000 mg, which is approximately seven times the recommended dose of the drug, was administered in clinical trials. There is no known specific antidote for casirivimab overdose so treatment of overdose should involve general supportive measures.[L39135] |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Antibodies |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Spike glycoprotein |
| Brand Name | Casirivimab |
| Company | Regeneron Pharmaceuticals, Inc. |
| Brand Description | Regeneron Pharmaceuticals, Inc. |
| Prescribed For | Intravenous |
| Chemical Name | 1332 mg/11.1mL |
| Formulation | NA |
| Physical Appearance | pain, bleeding, bruising of the skin, soreness, swelling, or infection at injection site |
| Route of Administration | On January 24, 2022, FDA reissued the emergency use authorization (EUA) for casirivimab and imdevimab stating that the combination regimen is not authorized for treatment of mild to moderate COVID-19 in geographic regions where infection is likely to have been caused by a non-susceptible SARS-CoV-2 variant based on available information including variant susceptibility to these drugs and regional variant frequency. Given the prevalence of the Omicron variant in the United States, casirivimab and imdevimab is not recommended for use anywhere for mild to moderate disease at the present time. |
| Recommended Dosage | to treat mild to moderate symptoms of COVID-19. to prevent COVID-19 in those who are not fully vaccinated against COVID-19 or who are vaccinated, but have a weakened immune system, or are taking a medication that affects the immune system and who have had close contact or are at high risk of close contact to someone who is infected with the SARS-CoV-2 virus (for example, nursing homes, prisons). |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |