Detailed description page of ThPDB2

This page displays user query in tabular form.

15866 details
Primary information
ID15866
Therapeutic IDTh1637
Protein NameBelantamab mafodotin
Sequence>Th1637_Belantamab_mafodotin QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARGAIYDGYDVLDNWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular WeightNA
Chemical FormulaNA
Isoelectric PointNA
HydrophobicityNA
Melting pointNA
Half-lifeThe terminal half life of belantamab mafodotin was 12 days after the first dose and 14 days at steady state.[L15326]
DescriptionBelantamab mafodotin, or GSK2857916, is an afucosylated monoclonal antibody that targets B cell maturation antigen conjugated to the microtubule distrupter monomethyl auristatin-F (MMAF).[A216756] Belantamab mafodotin was granted FDA approval on 5 August 2020.[L15326]
Indication/DiseaseBelantamab mafodotin is indicated in the treatment of adults with relapsed or refractory multiple myeloma who have received at least 4 prior therapies including an anti-CD38 monoclonal antibody, a proteasome inhibitor, and an immunomodulatory agent.[L15326]
PharmacodynamicsBelantamab mafodotin treats multiple myeloma through antibody dependant cell mediated cytotoxicity as well as G2/M cell cycle arrest.[A216771] It has a narrow therapeutic index due to the incidence of adverse effects, and a long duration of action as it is given every 3 weeks.[L15326] Patients should be counselled regarding the risk of keratopathy.[L15326]
Mechanism of ActionBelantamab mafodotin, or GSK2857916, is an afucosylated monoclonal antibody that targets B cell maturation antigen (BCMA) conjugated to the microtubule distrupter monomethyl auristatin-F (MMAF).[A216756] Afucosylation of the Fc region of monoclonal antibodies enhances binding to the Fc region, which enhances antibody dependant cell mediated cytoxicity.[A216771] BCMA is uniquely expressed on CD138-positive myeloma cells.[A216756] Targeting BCMA allows belantamab mafodotin to be highly selective in its delivery of MMAF to multiple myeloma cells.[A216756] Belantamab mafodotin binds to BCMA, is internalised into cells, and releases MMAF.[A216756] The MMAF payload binds to tubulin, stopping the cell cycle at the DNA damage checkpoint between the G2 and M phases, resulting in apoptosis.[A216771]
ToxicityData regarding overdose is not readily available.[L15326] However, keratopathy was seen in 71% of patients.[A216756,A216761,A216766,L15326]
MetabolismMonoclonal antibodies are expected to be metabolized to smaller peptides and amino acids.[L15326] MMAF is expected to be metabolized by oxidation and demethylation, however further data is not readily available.[A216781,A216776]
AbsorptionBelantamab mafodotin at a dose of 2.5mg/kg reaches a Cmax of 42 µg/mL, with a Tmax of 0.78 hours, and an AUC of 4666 µg
The mean steady state volume of distribution of belantamab mafodotin was 11 L.[L15326]
ClearanceThe clearance of belantamab mafodotin was 0.9 L/day after the first dose and 0.7 L/day at steady state.[L15326]
CategoriesAntibodies
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetTumor necrosis factor receptor superfamily member 17
Brand NameBlenrep
CompanyGlaxo Smith Kline (Ireland) Limited
Brand DescriptionGlaxo Smith Kline (Ireland) Limited
Prescribed ForIntravenous
Chemical Name100 mg
FormulationNone.
Physical Appearance keratopathy (corneal epithelium changes on eye exam), decreased visual acuity, nausea, blurred vision, fever, fatigue, infusion-related reactions, decreased platelets, decreased lymphocytes, decreased hemoglobin, decreased neutrophils, increased creatinine, increased gamma-glutamyl transferase, dry eyes, constipation, diarrhea, joint pain, back pain, decreased appetite, and upper respiratory tract infection
Route of AdministrationBlenrep is an antibody targeting B-cell maturation antigens (BCMA). Blenrep is used to treat multiple myeloma in adults. This medicine is given after at least 4 other treatments did not work or have stopped working. Blenrep was approved by the US Food and Drug Administration (FDA) on an "accelerated"...
Recommended DosageBLENREP is indicated for the treatment of adults with relapsed or refractory multiple myeloma who have received at least 4 prior therapies, including an anti-CD38 monoclonal antibody, a proteasome inhibitor, and an immunomodulatory agent.
ContraindicationNA
Side EffectsNA
Useful Link 1Link
Useful Link 2Link
RemarksNA