|
| Primary information |
|---|
| ID | 15669 |
| Therapeutic ID | Th1617 |
| Protein Name | Brolucizumab |
| Sequence | >Th1617_Brolucizumab
MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
|
| Molecular Weight | 26000 |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | The systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104] |
| Description | Brolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089] |
| Indication/Disease | Brolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089] |
| Pharmacodynamics | Brolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089] |
| Mechanism of Action | Brolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] |
| Toxicity | Data regarding the toxicity of brolucizumab is not readily available.[L9089] |
| Metabolism | Monoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470] |
| Absorption | A 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng |
| Data regarding the volume of distribution is not readily available.[L9089] |
| Clearance | Data regarding the clearance of brolucizumab is not readily available.[L9089] |
| Categories | Antibodies, Monoclonal, Humanized |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Vascular endothelial growth factor A |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |