| Primary information |
|---|
| ID | 15667 |
| Therapeutic ID | Th1617 |
| Protein Name | Brolucizumab |
| Sequence | >Th1617_Brolucizumab
MEIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS
|
| Molecular Weight | 26000 |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | The systemic half life of bolucizumab is 4.4±2.0 days.[L9089] The elimination half life is 108h for a 3mg dose and 103h for a 6mg dose.[L9104] |
| Description | Brolucizumab, also known as RTH258 or ESBA1008,[A187211] is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[L9089] Brolucizumab was granted FDA approval in October 2019.[L9089] |
| Indication/Disease | Brolucizumab is a monoclonal antibody indicated to treat neovascular age related macular degeneration.[A187208,L9089] |
| Pharmacodynamics | Brolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which reduces proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] It has a long duration of action as it is given monthly.[L9089] Patients should be counselled regarding the risk of endophthalmitis, retinal detachment, and arterial thromboembolic events following administration of this medication.[L9089] |
| Mechanism of Action | Brolucizumab is a vascular endothelial growth factor (VEGF) inhibitor which targets the major VEGF-A isoforms: VEGF110, VEGF121, and VEGF165.[A187196,A187208,L9089] Inhibition of these VEGF-A isoforms reduce proliferation of endothelial cells, vascularization of the tissue, and permeability of the vasculature.[L9089] |
| Toxicity | Data regarding the toxicity of brolucizumab is not readily available.[L9089] |
| Metabolism | Monoclonal antibodies are expected to undergo proteolysis to smaller peptides and amino acids.[A31470] |
| Absorption | A 3mg dose of brolucizumab reaches a Cmax of 20.7ng/mL with a Tmax of 20.3h and an AUC of 2480ng |
| Data regarding the volume of distribution is not readily available.[L9089] |
| Clearance | Data regarding the clearance of brolucizumab is not readily available.[L9089] |
| Categories | Antibodies |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Vascular endothelial growth factor A |
| Brand Name | Beovu |
| Company | Novartis Europharm Limited |
| Brand Description | Novartis Europharm Limited |
| Prescribed For | Intravitreal |
| Chemical Name | 120 mg/ml |
| Formulation | Ocular Or Periocular Infections BEOVU is contraindicated in patients with ocular or periocular infections. Active Intraocular Inflammation BEOVU is contraindicated in patients with active intraocular inflammation. Hypersensitivity BEOVU is contraindicated in patients with known hypersensitivity to brolucizumab or any of the excipients in BEOVU. Hypersensitivity reactions may manifest as rash, pruritus, urticaria, erythema, or severe intraocular inflammation. |
| Physical Appearance | blurred vision, cataracts, bleeding in the eye, eye pain, and eye "floaters" |
| Route of Administration | Beovu (brolucizumab-dbll) injection is a biological drug that is used to treat two chronic eye conditions. One is called neovascular (wet) age-related macular degeneration (AMD) and it is a leading cause of vision loss in people 50 years of age and over. The other is called diabetic macular edema (DME).... |
| Recommended Dosage | Beovu is a prescription medicine used to treat the symptoms of Macular Degeneration. Beovu may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | Brolucizumab-dbll is a recombinant human vascular endothelial growth factor inhibitor. Brolucizumab-dbll is a humanized monoclonal single-chain Fv (scFv) antibody fragment. Brolucizumab-dbll has a molecular weight of ~26 kilodaltons and is produced in Escherichia coli cells by recombinant DNA technology. |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |