|
| Primary information |
|---|
| ID | 15622 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Hormones |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Repronex |
| Company | Ferring Pharmaceuticals |
| Brand Description | Ferring Pharmaceuticals |
| Prescribed For | Intramuscular; Subcutaneous |
| Chemical Name | NA |
| Formulation | Repronex® (menotropins for injection) is contraindicated in women who have: A high FSH level indicating primary ovarian failure. Uncontrolled thyroid and adrenal dysfunction. An organic intracranial lesion such as a pituitary tumor. The presence of any cause of infertility other than anovulation unless they are candidates for in vitro-fertilization. Abnormal bleeding of undetermined origin. Ovarian cysts or enlargement not due to polycystic ovary syndrome. Prior hypersensitivity to menotropins. Repronex® (menotropins for injection) is not indicated in women who are pregnant. There are limited human data on the effects of menotropins when administered during pregnancy. |
| Physical Appearance | headache mild stomach pain bloating injection site reactions (redness, pain, swelling, or irritation) breast tenderness or enlargement dizziness ovarian enlargement (abdominal or pelvic pain, tenderness, pressure, or swelling) nausea vomiting diarrhea shortness of breath pain/warmth/tenderness centralized in an arm or leg fever chills drowsiness weakness or aching of muscles or joints, or rash |
| Route of Administration | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program... |
| Recommended Dosage | Repronex is a prescription medicine used to treat the symptoms of Ovulation Induction, Assisted Reproductive Technology (ART), and Spermatogenesis. Repronex may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | FOR SUBCUTANEOUS INJECTION AND INTRAMUSCULAR INJECTION |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |