|
| Primary information |
|---|
| ID | 15621 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Gonadotropins, Pituitary |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Pergonal 75 I.U. |
| Company | Emd Serono, A Division Of Emd Inc., Canada |
| Brand Description | Emd Serono, A Division Of Emd Inc., Canada |
| Prescribed For | Intramuscular |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Back pain breast tenderness feeling of warmth, redness of the face, neck, arms, and occasionally, upper chest menstrual changes muscle aches and pains unusual tiredness or weakness |
| Route of Administration | Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program called assisted reproductive technology (ART). ART uses procedures such as in vitro fertilization (IVF). Menotropins is used together with human chorionic gonadotropin (hCG) in these procedures. |
| Recommended Dosage | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |