|
| Primary information |
|---|
| ID | 15620 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Gonadotropins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Menopur |
| Company | Ferring Pharmaceuticals Inc. |
| Brand Description | Ferring Pharmaceuticals Inc. |
| Prescribed For | Subcutaneous |
| Chemical Name | NA |
| Formulation | MENOPUR® is contraindicated in women who exhibit: Prior hypersensitivity to MENOPUR® or menotropins products or one of their excipients High levels of FSH indicating primary ovarian failure [see INDICATIONS AND USAGE] Pregnancy MENOPUR® may cause fetal harm when administered to a pregnant woman [see Use in Specific Populations]. MENOPUR® is contraindicated in women who are pregnant. If this drug is used during pregnancy, or if the woman becomes pregnant while taking this drug, the woman should be apprised of the potential hazard to a fetus. Presence of uncontrolled non-gonadal endocrinopathies (e.g., thyroid, adrenal, or pituitary disorders) [see INDICATIONS AND USAGE] Sex hormone dependent tumors of the reproductive tract and accessory organs Tumors of pituitary gland or hypothalamus Abnormal uterine bleeding of undetermined origin Ovarian cyst or enlargement of undetermined origin, not due to polycystic ovary syndrome |
| Physical Appearance | headache, drowsiness, stomach or abdominal pain, bloating, injection site reactions (pain, swelling, irritation, redness), breast enlargement or tenderness, dizziness, nausea, vomiting, diarrhea, shortness of breath, pain/warmth/tenderness centralized in an arm or leg, fever, chills, weakness or aching of muscles or joints, or rash. |
| Route of Administration | Menotropins injection is used to treat infertility in women. Menotropins are a mixture of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) that are produced in the body by the pituitary gland. Menotropins injection is used in women with healthy ovaries who are enrolled in a fertility program... |
| Recommended Dosage | Menopur is a prescription medicine used to treat the symptoms of Ovulation Induction, Spermatogenesis and Assisted Reproductive Technology. Menopur may be used alone or with other medications. |
| Contraindication | NA |
| Side Effects | MENOPUR® is a preparation of gonadotropins (FSH and LH activity), extracted from the urine of postmenopausal women, which has undergone additional steps for purification. |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |