Detailed description page of ThPDB2
| This page displays user query in tabular form. |
15619 details |
| Primary information | |
|---|---|
| ID | 15619 |
| Therapeutic ID | Th1613 |
| Protein Name | Luteinizing hormone |
| Sequence | >Th1613_Luteinizing_hormone APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | NA |
| Pharmacodynamics | NA |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Humegon Inj 75 I.U. |
| Company | Organon Canada Ltd Ltee |
| Brand Description | Organon Canada Ltd Ltee |
| Prescribed For | Intramuscular |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Abdominal or stomach pain (severe) bloating (moderate to severe) chest pain or trouble breathing decreased amount of urine feeling of indigestion general feeling of discomfort or illness headache, severe and throbbing nausea, vomiting, or diarrhea (continuing or severe) pain or swelling in the arms or legs pelvic pain (severe) severe cramping of the uterus shortness of breath or wheezing swelling of the lower legs weight gain (rapid) |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | Link |
| Remarks | NA |