Detailed description page of ThPDB2
| This page displays user query in tabular form. |
12702 details |
| Primary information | |
|---|---|
| ID | 12702 |
| Therapeutic ID | Th1346 |
| Protein Name | Carotuximab |
| Sequence | >Th1346_Carotuximab EVKLEESGGGLVQPGGSMKLSCAASGFTFSDAWMDWVRQSPEKGLEWVAEIRSKASNHATYYAESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTRWRRFFDSWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | 0 |
| Indication/Disease | Investigated for use/treatment in solid tumors. |
| Pharmacodynamics | NA |
| Mechanism of Action | TRC105 is a first-in-class human chimeric monoclonal antibody that inhibits tumor growth by binding to CD105 (endoglin), a receptor over-expressed on proliferating endothelium that is required for angiogenesis (growth of new blood vessels). TRC105 has shown activity, as monotherapy or when combined with chemotherapy, in pre-clinical studies of breast and colorectal cancer. Pre-clinical data also indicate CD105 expression is increased following treatment of human cancer with anti-VEGF therapy. The target of TRC105 shares many features with the VEGF receptor. Most importantly, both the VEGF and CD105 receptors are essential for angiogenesis, in that deletion of either receptor prevents blood vessel formation in utero. [Traecon Pharmaceuticals Press Release] |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA | |
| Clearance | NA |
| Categories | Antibodies |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Endoglin |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |