Primary information |
---|
ID | 12575 |
Therapeutic ID | Th1335 |
Protein Name | Caplacizumab |
Sequence | >Th1335_Caplacizumab
EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSSAAAEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSS
|
Molecular Weight | 27880 |
Chemical Formula | C1213H1891N357O380S10 |
Isoelectric Point | 6.6 - 7.2 |
Hydrophobicity | NA |
Melting point | 61 ÂșC (Fab fragment) |
Half-life | The reported half-life is reported to be in the range of 16-27 hours.[F3457] |
Description | Caplacizumab, firstly called ALX-0081, is a humanized single-variable-domain immunoglobulin consisting of two identical humanized building blocks genetically linked by a three-alanine linker. Caplacizumab was developed by Ablynx, a Sanofi company and FDA approved on February 6, 2019,[L5302] and approved previously by the EU in October 2018 as a combination therapy with plasma exchange and immunosuppression.[A174634] |
Indication/Disease | Capacizumab is approved for the treatment of adults experiencing an episode of acquired thrombotic thrombocytopenic purpura (aTTP) in conjunction with plasma exchange and immunosuppression in patients 18 years or older.[A174634, L5302] aTTP is a rare autoimmune condition presented by a disruption of blood clotting order which is translated into systemic microvascular thrombosis leading to profound thrombocytopenia, hemolytic anemia and organ ischemia. It is caused by the production of autoantibodies against ADAMTS-13 which is the protein in charge of cleaving the von-Wilebrand factor. The lack of this process produces the generation of ultra large von Wilebrand multimers that bind to platelets and form microthrombi and causing thromboembolic complications.[A174649] Previously, capacizumab was under review for the prevention of thrombosis in high-risk patients with acute coronary syndrome undergoing percutaneous coronary intervention but this indication was withdrawn.[A174634] |
Pharmacodynamics | _In vitro_ studies have shown a caplacizumab-driven complete inhibition of platelet aggregation and in phase II clinical trials, it was shown to reduce the activity of the von Willebrand factor by 20% from treatment day 1 until treatment day 30. The level of von Willebrand factor in the plasma was also significantly reduced due to the clearance of the von Willebrand-caplacizumab complex.[A174634] In phase III clinical trials, more than 50% of the tested individuals reached a platelet normal count. In these trials, it was observed as well a significant reduction in the incidence of aTTP[A174634] as well as a significant reduction in the median time to response of about 39%.[A174652] However, as caplacizumab does not target autoimmune response, relapses were observed after treatment discontinuation.[A174643] The last clinical trial prior approval showed production of a platelet count of more than 150,000 per mcl after the cessation of plasma exchange therapy for 5 days as well as a reduction of patient recurrent thrombotic thrombocytopenic purpura and of disease-related death during treatment.[L5302] |
Mechanism of Action | Caplacizumab acts by targetting the A1 domain of the ultra-large von Willebrand factor which in order inhibits the interaction with the glycoprotein Ib-IX-V receptor in the platelets. Caplacizumab binds to von Willebrand factor with an affinity of 8.5 nM, thus it is very target specific.[5305] The blockage of the von Willebrand factor prevents the interaction between the von Willebrand factor and the platelets, hence, preventing platelet aggregation.[A174634] |
Toxicity | Cases of overdose are represented by an increased risk of bleeding and in these cases, external administration of von Willebrand factor concentrate should be done.[FDA label] To this point, there have not been performed studies regarding the effect on fertility, genotoxicity, or carcinogenicity |
Metabolism | Caplacizumab is degraded in the reticuloendothelial system to small peptides and amino acids which can be used for de-novo protein synthesis.[A31470] |
Absorption | After intravenous administration of caplacizumab, the pharmacokinetic profile is non-linear and to follow a non-compartmental model as the pharmacokinetic profile of this drug is dependent on the expression of von Willebrand factor. After administration, caplacizumab is rapidly absorbed with a dose-dependent behavior. The peak concentration was reached after 6-7 hours[A174634] and it presents a very high bioavailability reaching approximately 90%.[F3457] The subcutaneous administration of a dose of 10 mg of caplacizumab produced a peak concentration of 528 ng/ml and an AUC of 7951 ng.h/ml.[L5314] |
| The reported volume of distribution of caplacizumab is 6.33 L.[A174634] |
Clearance | As the elimination is highly divided among hepatic, target-driven and renal elimination, the calculation of the clearance rate is not significant for drug description. |
Categories | Antibodies, Monoclonal |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | von Willebrand factor |
Brand Name | Cablivi |
Company | Ablynx Nv |
Brand Description | Ablynx Nv |
Prescribed For | Intravenous; Subcutaneous |
Chemical Name | 10 mg |
Formulation | CABLIVI is contraindicated in patients with a previous severe hypersensitivity reaction to caplacizumab-yhdp or to any of the excipients. Hypersensitivity reactions have included urticaria |
Physical Appearance | nosebleed, headache, bleeding gums, fatigue, fever, injection site reactions (bleeding, itching), back pain, muscle pain, numbness and tingling, urinary tract infection (UTI), blood in the urine, abnormal vaginal bleeding, shortness of breath, and hives |
Route of Administration | Cablivi is used to treat acquired thrombotic thrombocytopenic purpura (aTTP) in adults. This medicine is given together with immunosuppressant medication and plasma exchange (transfusion). Cablivi may also be used for purposes not listed in this medication guide. Warnings Cablivi can increase your risk... |
Recommended Dosage | Cablivi is a prescription medicine used to treat the symptoms of Acquired Thrombotic Thrombocytopenia Purpura (aTTP). Cablivi may be used alone or with other medications. |
Contraindication | NA |
Side Effects | Caplacizumab-yhdp is a von Willebrand factor (vWF)-directed antibody fragment that consists of two identical humanized building blocks, linked by a three-alanine linker. Caplacizumab-yhdp is produced in Escherichia coli by recombinant DNA technology and has an approximate molecular weight of 28 kDa. |
Useful Link 1 | Link |
Useful Link 2 | Link |
Remarks | NA |