Primary information |
---|
ID | 12183 |
Therapeutic ID | Th1296 |
Protein Name | Ciliary neurotrophic factor |
Sequence | >Th1296_Ciliary_neurotrophic_factor
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
|
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Ciliary neurotrophic factor (NT-501) is Neurotech's lead product which is in two Phase II/III clinical trials for the treatment of visual loss associated with retinitis pigmentosa and a Phase II trial for the treatment of the dry form of age-related macular degeneration. Neurotech is also evaluating other factors that can be used with its proprietary delivery technology, Encapsulated Cell Technology (ECT), to treat additional retinal diseases. |
Indication/Disease | Investigated for use/treatment in eye disorders/infections, macular degeneration, and retinal disorders (unspecified). |
Pharmacodynamics | NA |
Mechanism of Action | NT-501 is an intraocular, cell containing polymer implant designed to provide the continuous, long-term release of the therapeutic protein, Ciliary Neurotrophic Factor (CNTF), directly into the back of the eye by means of the Company's proprietary Encapsulated Cell Technology (ECT). |
Toxicity | NA |
Metabolism | NA |
Absorption | NA |
| NA |
Clearance | NA |
Categories | Intercellular Signaling Peptides and Proteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | NA |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |