Primary information |
---|
ID | 12038 |
Therapeutic ID | Th1280 |
Protein Name | CR002 |
Sequence | >Th1280_CR002
MVRHPYSVQTQLSTEAKAIWRSMQQQETNLLANLTTNDARDNSKDFQNSKVGAAATSRDEGCNCPIIGEIVISCYWLFEIPPLISE
|
Molecular Weight | NA |
Chemical Formula | NA |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | CR002 is a novel investigational fully human monoclonal antibody that blocks the activity of excess platelet-derived growth factor-D (PDGF-D), a target shown to play a role in kidney inflammation. This is a novel therapeutic approach to treat kidney inflammation. |
Indication/Disease | Investigated for use/treatment in nephropathy. |
Pharmacodynamics | NA |
Mechanism of Action | CR002 blocks the activity of excess platelet-derived growth factor-D (PDGF-D), a target shown to play a role in kidney inflammation. Diabetic nephropathy, IgA nephropathy, and lupus nephritis are histologically characterized by glomerular mesangial cell proliferation and extracellular matrix accumulation. PDGF-D and its receptors play an important role in the pathogenesis of nephritis, based on their potent induction of mesangial cell proliferation and extracellular matrix accumulation shown both in vitro and in vivo. A fully human monoclonal antibody that neutralizes PDGF-D represents a novel therapeutic approach to block nephritides. |
Toxicity | NA |
Metabolism | NA |
Absorption | NA |
| NA |
Clearance | NA |
Categories | Blood Proteins |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | NA |
Target | Platelet-derived growth factor D |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |