| Primary information |
|---|
| ID | 11557 |
| Therapeutic ID | Th1250 |
| Protein Name | Pegademase |
| Sequence | >Th1250_Pegademase
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAEQCL
|
| Molecular Weight | 40788.2 |
| Chemical Formula | C1821H2834N484O552S14 |
| Isoelectric Point | 5.33 |
| Hydrophobicity | -0.428 |
| Melting point | NA |
| Half-life | plasma adenosine deaminase elimination half-life is 3 to >6 days |
| Description | Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life. |
| Indication/Disease | For treatment of adenosine deaminase deficiency |
| Pharmacodynamics | Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function. |
| Mechanism of Action | Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak for plasma adenosine deaminase is 2 to 3 days |
| NA |
| Clearance | NA |
| Categories | Antineoplastic and Immunomodulating Agents |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | Adenosine,Growth factor receptor-bound protein 2 |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |