| Primary information |
|---|
| ID | 10795 |
| Therapeutic ID | Th1185 |
| Protein Name | Human clostridium tetani toxoid immune globulin |
| Sequence | >Th1185_Human_clostridium_tetani_toxoid_immune_globulin
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | 23 days |
| Description | NA |
| Indication/Disease | It is indicated for prophylaxis against tetanus following injury in patients whose immunization is incomplete or uncertain (see below). It is also indicated, although evidence of effectiveness is limited, in the regimen of treatment of active cases of tetanus. |
| Pharmacodynamics | It supplies passive immunity to those individuals who have low or no immunity to the toxin produced by the tetanus organism, Clostridium tetani. The antibodies act to neutralize the free form of the powerful exotoxin produced by this bacterium. |
| Mechanism of Action | NA |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Hypertet S/d |
| Company | GRIFOLS USA, LLC |
| Brand Description | GRIFOLS USA, LLC |
| Prescribed For | HyperTET S/D is indicated for prophylaxis against tetanus following injury in patients whose immunization is incomplete or uncertain (see below). It is also indicated, although evidence of effectiveness is limited, in the regimen of treatment of active cases of tetanus. |
| Chemical Name | NA |
| Formulation | 250 [iU]/mL |
| Physical Appearance | Injection |
| Route of Administration | Intramuscular |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Slight soreness at the site of injection and slight temperature elevation may be noted at times. Sensitization to repeated injections of human immunoglobulin is extremely rare. In the course of routine injections of large numbers of persons with immunoglobulin there have been a few isolated occurrences of angio neurotic edema, nephrotic syndrome, and anaphylactic shock after injection. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |