| Primary information |
|---|
| ID | 10682 |
| Therapeutic ID | Th1150 |
| Protein Name | Secukinumab |
| Sequence | >Th1150_Secukinumab
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVAAINQDGSEKYYVGSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCVRDYYDILTDYYIHYWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Molecular Weight | 147940 |
| Chemical Formula | C6584H10134N1754O2042S44 |
| Isoelectric Point | NA |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | 22-31 days |
| Description | A human monoclonal antibody, secukinumab (cosentyx) was designed for the treatment of uveitis, rheumatoid arthritis, ankylosing spondylitis, and psoriasis. Secukinumab is an interleukin-17A inhibitor marketed by Novartis. On January 19, 2015, secukinumab was approved by the European Commission as a first line systemic treatment in moderate to severe adult plaque psoriasis. On January 21, 2015, the United States Food and Drug Administration announced that it had approved secukinumab to treat adults with moderate-to-severe plaque psoriasis. |
| Indication/Disease | It is a human interleukin-17A antagonist indicated for the treatment of moderate to severe plaque psoriasis in adult patients who are candidates for systemic therapy or phototherapy. |
| Pharmacodynamics | Elevated levels of IL-17A are found in psoriatic plaques. Treatment with cosentyx may reduce epidermal neutrophils and IL-17A levels in psoriatic plaques. Serum levels of total IL-17A (free and secukinumab-bound IL-17A) measured at Week 4 and Week 12 were increased following secukinumab treatment. These pharmacodynamic activities are based on small exploratory studies. The relationship between these pharmacodynamic activities and the mechanism(s) by which secukinumab exerts its clinical effects is unknown. |
| Mechanism of Action | Secukinumab is a human IgG1 monoclonal antibody that selectively binds to the interleukin-17A (IL-17A) cytokine and inhibits its interaction with the IL-17 receptor. IL-17A is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Secukinumab inhibits the release of proinflammatory cytokines and chemokines. |
| Toxicity | NA |
| Metabolism | Mainly intracellular breakdown. |
| Absorption | Bioavailability after subcutaneous administration was 55-77%. |
| Volume of distribution (Vd) in interstitial fluid of skin (+/- psoriasis) was 27-40% of that in serum after single subcutaneous dose of 300 mg. Vd increased at higher body weights. |
| Clearance | Serum clearance was increased with higher body weights. |
| Categories | Inhibitor |
| Patents Number | US20130202610 |
| Date of Issue | 10-Aug-2010 |
| Date of Expiry | 10-Aug-2020 |
| Drug Interaction | NA |
| Target | Interleukin-17A |
| Brand Name | Cosentyx |
| Company | Novartis Pharmaceuticals Corporation |
| Brand Description | Novartis Pharmaceuticals Corporation |
| Prescribed For | Cosentyx is indicated for the treatment of moderate to severe plaque psoriasis in adult patients who are candidates for systemic therapy or phototherapy. |
| Chemical Name | NA |
| Formulation | Each cosentyx sensoready pen or prefilled syringe contains 150 mg of secukinumab formulated in: Lhistidine/ histidine hydrochloride monohydrate (3.103 mg), L-methionine (0.746 mg), polysorbate 80 (0.2 mg), trehalose dihydrate (75.67 mg), and Sterile Water for Injection, USP, at pH of 5.8. |
| Physical Appearance | Cosentyx injection is a sterile, preservative-free, clear to slightly opalescent, colorless to slightly yellow solution. |
| Route of Administration | Subcutaneous injection |
| Recommended Dosage | The recommended dose is 300 mg by subcutaneous injection at Weeks 0, 1, 2, 3, and 4 followed by 300 mg every 4 weeks. Each 300 mg dose is given as 2 subcutaneous injections of 150 mg. For some patients, a dose of 150 mg may be acceptable. |
| Contraindication | Patients with a previous serious hypersensitivity reaction to secukinumab or to any of the excipients |
| Side Effects | Crohn’s disease “flare-ups†(worsening Crohn’s disease), serious allergic reactions, chest tightness, swelling of your face, eyelids, lips, mouth, tongue, or throat, trouble breathing or throat tightness, skin rash and upper respiratory infections |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |