|
| Primary information |
|---|
| ID | 10667 |
| Therapeutic ID | Th1144 |
| Protein Name | Follitropin alpha |
| Sequence | >Th1144_Follitropin_alpha
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | 22672.9 |
| Chemical Formula | C975H1513N267O304S26 |
| Isoelectric Point | 7.5 |
| Hydrophobicity | NA |
| Melting point | NA |
| Half-life | NA |
| Description | Recombinant (CHO cell derived) human follicle stimulating hormone (FSH). It consists of two non-covalently linked, non-identical glycoproteins designated as the alpha (92 amino acids)- and beta (111 amino acids)- subunits. The alpha subunit is glycosylated at N51 and N78 while the beta subunit is glycosylated at N7 and N24. Follitropin alpha was the world's first recombinant human FSH preparation. The term “alpha†differentiates it from another recombinant human FSH product that was marketed later as follitropin beta. Follitropin is important in the development of follicles produced by the ovaries. Given by subcutaneous injection, it is used in combination with human chorionic gonadotropin (hCG) to assist in ovulation and fertility. Follitropin may also be used to cause the ovary to produce several follicles, which can then be harvested for use in gamete intrafallopian transfer (GIFT) or in vitro fertilization (IVF). Numerous physio-chemical tests and bioassays indicate that follitropin beta and follitropin alpha are indistinguishable. However, a more recent study showed there is may be a slight clinical difference, with the alpha form tending towards a higher pregnancy rate than beta but with significantly higher estradiol (E2) levels. The amino acid sequence of follitropin beta is identical to that of natural human follicle stimulating hormone (FSH). Further, the ogliosaccharide side-chains are very similar, but not completely identical to that of natural FSH. However, these small differences do not affect the bioactivity compared to natural FSH. |
| Indication/Disease | In women having been diagnosed with primary ovarian failure, it is used in combination with human chorionic gonadotropin (hCG) to assist in ovulation and fertility. In men with hypogonadotrophic hypogonadism, it is used to induce spermatogenesis. Follitropin may also be used to cause the ovary to produce several follicles, which can then be harvested for use in gamete intrafallopian transfer (GIFT) or in vitro fertilization (IVF) |
| Pharmacodynamics | The main pharmacodynamic parameters are serum inhibin, estradiol and total follicular volume with daily injections of follitropin. The quickest response was noticed with serum inhibin, which declined rapidly after discontinuation. Follicular growth showed late response and continued even after discontinuation of the drug and after decline of the serum concentrations. Thus follicular growth was better correlated with serum inhibin and estradiol rather than peal levels of the drug. It should be noted that there is great inter-individual variability |
| Mechanism of Action | Follitropin is important for spermatogenesis, gonadal steroid production and follicule growth and maturation |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | NA |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Gonal-f RFF |
| Company | EMD SERONO |
| Brand Description | EMD SERONO |
| Prescribed For | ovulation and pregnancy in the oligo-anovulatory infertile patient in whom the cause of infertility is functional and not due to primary ovarian failure, development of multiple follicles in the ovulatory patient participating in an Assisted Reproductive Technology (ART) program. |
| Chemical Name | NA |
| Formulation | Each Gonal-f RFF single-dose vial is filled with 82 IU (6 µg)follitropin alfa to deliver 75 IU (5.5 µg) follitropin alfa and contains 30 mg sucrose, 1.11 mg dibasic sodium phosphate dihydrate, 0.45 mg monobasic sodium phosphate monohydrate, 0.1 mg methionine, and 0.05 mg polysorbate 20. Phosphoric acid and/or sodium hydroxide may be used prior to lyophilization for pH adjustment. Vials are reconstituted with Sterile Water for Injection, USP. |
| Physical Appearance | Gonal-f RFF (follitropin alfa injection) is a sterile, lyophilized powder intended for subcutaneous injection after reconstitution. |
| Route of Administration | Subcutaneous Injection |
| Recommended Dosage | 300 IU per day |
| Contraindication | Prior hypersensitivity to recombinant FSH preparations or one of their excipients, High levels of FSH indicating primary ovarian failure., Uncontrolled thyroid or adrenal dysfunction, An organic intracranial lesion such as a pituitary tumor, Sex hormone dependent tumors of the reproductive tract and accessory organs, Abnormal uterine bleeding of undetermined origin, Ovarian cyst or enlargement of undetermined origin, Pregnancy. |
| Side Effects | Headache, Dizziness, Migraine, Abdominal Pain, Nausea, Flatulence, Diarrhea, Toothache, Dyspepsia, Constipation, Stomatitis Ulcerative, Ovarian Cyst, Reproductive, Female, Ovarian Hyperstimulation, Breast Pain Female, Vaginal Haemorrhage, Gynecological-related pain, Uterine haemorrhage, Sinusitis, Pharyngitis, Rhinitis, Coughing, Injection Site Pain, Injection Site Inflammation, Back Pain, Pain, Fever, Hot Flushes, Malaise, Acne, Micturition Frequency, Cystitis, Infection viral. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |