Primary information |
---|
ID | 10587 |
Therapeutic ID | Th1120 |
Protein Name | Teriparatide |
Sequence | >Th1120_Teriparatide
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
|
Molecular Weight | 4117.715 |
Chemical Formula | C181H291N55O51S2 |
Isoelectric Point | NA |
Hydrophobicity | NA |
Melting point | NA |
Half-life | NA |
Description | Recombinant, human parathyroid hormone (PTH). It is a potent anabolic agent used to treat osteoporosis. It is manufactured and marketed by Eli Lilly and Company. |
Indication/Disease | For the treatment of osteoporosis in men and postmenopausal women who are at high risk for having a fracture. Also used to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture. |
Pharmacodynamics | Clinical trials indicate that teriparatide increases predominantly trabecular bone in the lumbar spine and femoral neck; it has less significant effects at cortical sites. The combination of teriparatide with antiresorptive agents is not more effective than teriparatide monotherapy. The most common adverse effects associated with teriparatide include injection-site pain, nausea, headaches, leg cramps, and dizziness. After a maximum of two years of teriparatide therapy, the drug should be discontinued and antiresorptive therapy begun to maintain bone mineral density. |
Mechanism of Action | Teriparatide is the portion of human parathyroid hormone (PTH),amino acid sequence 1 through 34 of the complete molecule which contains amino acid sequence 1 to 84. Endogenous PTH is the primary regulator of calcium and phosphate metabolism in bone and kidney. Daily injections of teriparatide stimulate new bone formation leading to increased bone mineral density. |
Toxicity | Effects of overexposure may include headaches, dizziness, dizziness, decreased blood pressured, decreased fetal survival, leg cramps, changes in clinical chemistry including increased in blood levels of calcium, decreased serum phosphorous, and increased urinary calcium and phosphorus. |
Metabolism | Hepatic |
Absorption | Bioavailability is 95% following subcutaneous injection. |
| 0.12 L/kg |
Clearance | * 62 L/hr [Women] * 94 L/hr [Men] |
Categories | Bone Density Conservation Agents |
Patents Number | CA2325371 |
Date of Issue | 17-08-2004 |
Date of Expiry | 19-08-2019 |
Drug Interaction | NA |
Target | Parathyroid hormone/parathyroid hormone-related peptide receptor |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | NA |
Useful Link 2 | NA |
Remarks | NA |