Detailed description page of ThPDB2

This page displays user query in tabular form.

10479 details
Primary information
ID10479
Therapeutic IDTh1088
Protein NameEnfuvirtide
Sequence>Th1088_Enfuvirtide YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF
Molecular Weight4491.876
Chemical FormulaC204H301N51O64
Isoelectric Point4.3
Hydrophobicity-0.875
Melting pointNA
Half-life3.8 ± 0.6 hrs
Description36 residue, synthetically prepared peptide with N-terminal acetylation and C-terminal amidation. It blocks the fusion of HIV-1 with CD4 cells.
Indication/DiseaseEnfuvirtide is an antiretroviral drug used in combination therapy for the treatment of HIV-1/AIDS.
PharmacodynamicsNA
Mechanism of ActionEnfuvirtide binds to the first heptad-repeat (HR1) in the gp41 subunit of the viral envelope glycoprotein and prevents the conformational changes required for the fusion of viral and cellular membranes. It works by disrupting the HIV-1 molecular machinery at the final stage of fusion with the target cell, preventing uninfected cells from becoming infected. Enfuvirtide is a biomimetic peptide that was rationally designed to mimic components of the HIV-1 fusion machinery and displace them, preventing normal fusion.
ToxicityNA
MetabolismExpected to undergo catabolism to its constituent amino acids, with subsequent recycling of the amino acids in the body pool.
AbsorptionAfter a 90 mg single subcutaneous injection of Enfuvirtide into the abdomen in 12 HIV-1 infected subjects, the mean peak concentration is 4.59±1.5 ug/ml and the median time to peak concentration was 8 hours (ranged from 3 to12 hours).
5.5 ± 1.1 L
Clearance24.8 +/- 4.1 mL/h/kg [HIV-1 infected adult and pediatric subjects following a 90-mg single SC dose of enfuvirtide] 30.6 +/- 10.6 mL/h/kg [Following 90-mg twice daily dosing of FUZEON SC in combination with other antiretroviral agents in HIV-1 infected subjects] 40 +/- 17 mL/h/kg [pediatric patients in the presence of concomitant medications including antiretroviral agents receiving the 2 mg/kg twice daily dose]
CategoriesAmino Acids, Peptides, and Proteins,Anti-HIV Agents,Anti-Infective Agents,Anti-Retroviral Agents,Antigens,Antigens, Viral,Antiinfectives for Systemic Use,Antiviral Agents,Antivirals for Systemic Use,Biological Factors,Cytochrome P-450 CYP2C19 Substrates,Cytochrome P-450 CYP2E1 Substrates,Cytochrome P-450 Substrates,Direct Acting Antivirals,env Gene Products, Human Immunodeficiency Virus,Fusion Protein Inhibitors,Gene Products, env,HIV Antigens,HIV Envelope Protein gp41,HIV Fusion Inhibitors,Human Immunodeficiency Virus 1 Fusion Inhibitor,Human Immunodeficiency Virus Proteins,Membrane Fusion Proteins,Membrane Proteins,Peptide Fragments,Peptides,Polyproteins,Proteins,Retroviridae Proteins,Viral Envelope Proteins,Viral Fusion Protein Inhibitors,Viral Fusion Proteins,Viral Proteins,Viral Structural Proteins
Patents NumberUS5464933
Date of Issue7-Nov-1995
Date of Expiry7-Jun-2013
Drug InteractionNA
TargetEnvelope glycoprotein
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsNA
Useful Link 1NA
Useful Link 2NA
RemarksNA