|
| Primary information |
|---|
| ID | 10452 |
| Therapeutic ID | Th1080 |
| Protein Name | Choriogonadotropin alfa |
| Sequence | >Th1080_Choriogonadotropin_alfa
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | 25719.7 |
| Chemical Formula | C1105H1770N318O336S26 |
| Isoelectric Point | 8.61 |
| Hydrophobicity | -0.258 |
| Melting point | 55 |
| Half-life | Mean terminal half-life 29 ± 6 hr (initial half-life is 4.5± 0.5 hr) |
| Description | Recombinant human chorionic gonadotropin with a 92-residue alpha subunit and a 145 residue beta subunit. Glycosylation consists of N-and O-linked carbohydrate moieties linked to N-52 and N-78 (on alpha subunit) and N13 and 30, S121, 127, 132 and 138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH. |
| Indication/Disease | For the treatment of female infertility |
| Pharmacodynamics | Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. |
| Mechanism of Action | Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%. |
| 5.9 ± 1.0 L |
| Clearance | 0.29 ± 0.04 L/h [healthy down-regulated females] |
| Categories | Genito Urinary System and Sex Hormones,Gonadotropins,Gonadotropins and Antigonadotropins,Sex Hormones and Modulators of the Genital System |
| Patents Number | US5767251 |
| Date of Issue | 16-Jun-1998 |
| Date of Expiry | 16-Jun-2015 |
| Drug Interaction | NA |
| Target | Lutropin-choriogonadotropic hormone receptor,Follicle-stimulating hormone receptor |
| Brand Name | Chorionic Gonadotropin |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |