Primary information |
---|
ID | 10451 |
Therapeutic ID | Th1080 |
Protein Name | Choriogonadotropin alfa |
Sequence | >Th1080_Choriogonadotropin_alfa
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
Molecular Weight | 25719.7 |
Chemical Formula | C1105H1770N318O336S26 |
Isoelectric Point | 8.61 |
Hydrophobicity | -0.258 |
Melting point | 55 |
Half-life | Mean terminal half-life 29 ± 6 hr (initial half-life is 4.5± 0.5 hr) |
Description | Recombinant human chorionic gonadotropin with a 92-residue alpha subunit and a 145 residue beta subunit. Glycosylation consists of N-and O-linked carbohydrate moieties linked to N-52 and N-78 (on alpha subunit) and N13 and 30, S121, 127, 132 and 138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH. |
Indication/Disease | For the treatment of female infertility |
Pharmacodynamics | Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. |
Mechanism of Action | Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone. |
Toxicity | NA |
Metabolism | NA |
Absorption | The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%. |
| 5.9 ± 1.0 L |
Clearance | 0.29 ± 0.04 L/h [healthy down-regulated females] |
Categories | Genito Urinary System and Sex Hormones,Gonadotropins,Gonadotropins and Antigonadotropins,Sex Hormones and Modulators of the Genital System |
Patents Number | US5767251 |
Date of Issue | 16-Jun-1998 |
Date of Expiry | 16-Jun-2015 |
Drug Interaction | NA |
Target | Lutropin-choriogonadotropic hormone receptor,Follicle-stimulating hormone receptor |
Brand Name | Pregnyl |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | NA |
Side Effects | NA |
Useful Link 1 | NA |
Useful Link 2 | NA |
Remarks | NA |