| Primary information |
|---|
| ID | 10448 |
| Therapeutic ID | Th1080 |
| Protein Name | Choriogonadotropin alfa |
| Sequence | >Th1080_Choriogonadotropin_alfa
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | 25719.7 |
| Chemical Formula | C1105H1770N318O336S26 |
| Isoelectric Point | 8.61 |
| Hydrophobicity | -0.258 |
| Melting point | 55 |
| Half-life | Mean terminal half-life 29 ± 6 hr (initial half-life is 4.5± 0.5 hr) |
| Description | Recombinant human chorionic gonadotropin with a 92-residue alpha subunit and a 145 residue beta subunit. Glycosylation consists of N-and O-linked carbohydrate moieties linked to N-52 and N-78 (on alpha subunit) and N13 and 30, S121, 127, 132 and 138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH. |
| Indication/Disease | For the treatment of female infertility |
| Pharmacodynamics | Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. |
| Mechanism of Action | Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%. |
| 5.9 ± 1.0 L |
| Clearance | 0.29 ± 0.04 L/h [healthy down-regulated females] |
| Categories | Genito Urinary System and Sex Hormones,Gonadotropins,Gonadotropins and Antigonadotropins,Sex Hormones and Modulators of the Genital System |
| Patents Number | US6706681 |
| Date of Issue | 16-Mar-2004 |
| Date of Expiry | 16-Mar-2021 |
| Drug Interaction | NA |
| Target | Lutropin-choriogonadotropic hormone receptor,Follicle-stimulating hormone receptor |
| Brand Name | Choriogonadotropin alfa |
| Company | Emd serono inc, Ferring pharmaceuticals inc, App pharmaceuticals llc, Bel mar laboratories inc, Bris |
| Brand Description | Emd serono inc, Ferring pharmaceuticals inc, App pharmaceuticals llc, Bel mar laboratories inc, Bris |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | Chorionic Gonadotropin for Injection, USP is available in multiple dose vials containing 10,000 USP Units with accompanying Bacteriostatic Water for Injection for reconstitution. When reconstituted with 10 mL of the accompanying diluent each vial contains: Chorionic Gonadotropin 10,000 Units, Mannitol 100 mg, Benzyl alcohol 0.9%, Water for Injection q.s. Buffered with dibasic sodium phosphate and monobasic sodium phosphate. Hydrochloric acid and/or sodium hydroxide may have been used for pH adjustment (6.0-8.0). Nitrogen gas is used in the freeze drying process. |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | Adult Dose for Ovulation Induction: Ovulation Induction (if the cause of anovulation is secondary and not due to primary ovarian failure): chorionic gonadotropin: 5000 to 10,000 units IM one day following last day of menotropins. recombinant chorionic gonadotropin: 250 mcg subcutaneously one day following last dose of follicle-stimulating agent. Usual Adult Dose for Hypogonadism - Male hypogonadotropic hypogonadism (secondary to a pituitary deficiency):500 to 1000 units IM three times a week for 3 weeks followed by the same dose twice a week for 3 weeks or, 4000 units IM three times a week for 6 to 9 months followed by 2000 units three times a week for an additional 3 months. |
| Contraindication | Nausea; pain, swelling, bruising, or redness at the injection site; vomiting. Severe allergic reactions, bloating or swelling in the stomach or pelvic area; breast pain; calf or leg pain, redness, swelling, or tenderness; chest pain; decreased urination; irregular heartbeat; persistent or severe nausea, vomiting, or diarrhea; severe pelvic pain; severe stomach pain or bloating; sudden shortness of breath; sudden, unexpected weight gain. The principal serious adverse reactions are: (1) Ovarian hyperstimulation, a syndrome of sudden ovarian enlargement, ascites with or without pain and/or pleural effusion, (2) Rupture of ovarian cysts with resultant hemoperitoneum, (3) Multiple births and (4) Arterial thromboembolism. Anaphylaxis and other hypersensitivity reactions have been reported with urinary-derived HCG products. |
| Side Effects | NA |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |