|
| Primary information |
|---|
| ID | 10308 |
| Therapeutic ID | Th1043 |
| Protein Name | Rasburicase |
| Sequence | >Th1043_Rasburicase
SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL
|
| Molecular Weight | 34109.5 |
| Chemical Formula | C1521H2381N417O461S7 |
| Isoelectric Point | 7.16 |
| Hydrophobicity | -0.465 |
| Melting point | NA |
| Half-life | 18 hours |
| Description | Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae< strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Indication/Disease | For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy). |
| Pharmacodynamics | Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of Action | Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Antigout Preparations, Detoxifying Agents for Antineoplastic Treatment, Enzymes, Enzymes and Coenzymes, Methemoglobinemia Associated Agents, Musculo-Skeletal System, Oxidoreductases, Recombinant Proteins, Uric Acid-specific Enzyme |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Cyanide Antidote Kit (amyl nitrite / sodium nitrite / sodium thiosulfate) |
| Target | NA |
| Brand Name | Fasturtec |
| Company | Sanofi Aventis |
| Brand Description | Sanofi Aventis |
| Prescribed For | Fasturtec is used to treat and prevent high levels of uric acid in the blood in order to prevent kidney failure. It is used in adults and children with blood cancers who are at risk of a sudden rise in uric acid levels when they start to receive chemother |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | Powder and solvent that are made upto make solution. |
| Route of Administration | Intravenous administartion |
| Recommended Dosage | The recommended dose is 0.2 mg per kilogram body weight in both children and adults, given as a daily infusion for up to seven days. The duration of treatment is adjusted depending on the patient’s blood levels of uric acid and the doctor’s judgment. |
| Contraindication | Hypersensitivity |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; blue or gray skin color; chest pain; chills; coughing up blood; dark urine; fever; irregular heartbeat; numbness or tingling of the skin; persistent sore throat; severe dizziness; shortness of breath, trouble breathing, or wheezing; swelling of the hands or feet; weakness; yellowing of the eyes and skin. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |