| Primary information |
|---|
| ID | 10267 |
| Therapeutic ID | Th1038 |
| Protein Name | Omalizumab |
| Sequence | >Th1038_Omalizumab
EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYADSVKGRFTISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
| Molecular Weight | 149000 |
| Chemical Formula | C6450H9916N1714O2023S38 |
| Isoelectric Point | 6.6 - 7.4 |
| Hydrophobicity | -0.432 |
| Melting point | 61(FAB fra |
| Half-life | 624 hours |
| Description | A recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. |
| Indication/Disease | For treatment of asthma caused by allergies |
| Pharmacodynamics | Xolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. |
| Mechanism of Action | Xolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils. |
| Toxicity | Anaphylaxis may occur rarely with this agent, either after the first dose or multiple doses |
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system. |
| Absorption | bioavailability of 62% |
| 78 ± 32 mL/kg |
| Clearance | Liver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile. |
| Categories | Agents to Treat Airway Disease, Amino Acids, Peptides, and Proteins, Anti-Allergic Agents, Anti-Asthmatic Agents, Anti-IgE, Antibodies, Antibodies, Monoclonal, Antibodies, Monoclonal, Humanized, Blood Proteins, Decreased IgE Activity, Globulins, IgE-directed Antibody Interactions, Immunoglobulins, Immunoproteins, Proteins, Respiratory Agents, Miscellaneous, Respiratory System Agents, Serum Globulins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |