Detailed description page of ThPDB2

This page displays user query in tabular form.

10266 details
Primary information
ID10266
Therapeutic IDTh1038
Protein NameOmalizumab
Sequence>Th1038_Omalizumab EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYADSVKGRFTISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight149000
Chemical FormulaC6450H9916N1714O2023S38
Isoelectric Point6.6 - 7.3
Hydrophobicity-0.432
Melting point61(FAB fra
Half-life624 hours
DescriptionA recombinant DNA-derived humanized IgG1k monoclonal antibody that selectively binds to human immunoglobulin E. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin.
Indication/DiseaseFor treatment of asthma caused by allergies
PharmacodynamicsXolair inhibits the binding of IgE to the high-affinity IgE receptor (FceRI) on the surface of mast cells and basophils. Reduction in surface-bound IgE on FceRI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma.
Mechanism of ActionXolair binds to IgE (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.
ToxicityAnaphylaxis may occur rarely with this agent, either after the first dose or multiple doses
MetabolismMost likely removed by opsonization via the reticuloendothelial system.
Absorptionbioavailability of 62%
78 ± 32 mL/kg
ClearanceLiver elimination of IgG includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact IgG is also excreted in bile.
CategoriesAgents to Treat Airway Disease, Amino Acids, Peptides, and Proteins, Anti-Allergic Agents, Anti-Asthmatic Agents, Anti-IgE, Antibodies, Antibodies, Monoclonal, Antibodies, Monoclonal, Humanized, Blood Proteins, Decreased IgE Activity, Globulins, IgE-directed Antibody Interactions, Immunoglobulins, Immunoproteins, Proteins, Respiratory Agents, Miscellaneous, Respiratory System Agents, Serum Globulins
Patents NumberCA1340233
Date of Issue15-Dec-1998
Date of Expiry15-Dec-2015
Drug InteractionNA
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsPain; headache, tired feeling; joint or muscle pain; dizziness; ear pain; hair loss; mild itching or skin rash; sore throat or cold symptoms; or redness, bruising, warmth, burning, stinging, itching, pain, or swelling of your skin where the injection was given.
Useful Link 1Link
Useful Link 2NA
RemarksNA