| Primary information |
|---|
| ID | 10249 |
| Therapeutic ID | Th1034 |
| Protein Name | Palifermin |
| Sequence | >Th1034_Palifermin
MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
|
| Molecular Weight | 16192.7 |
| Chemical Formula | C721H1142N202O204S9 |
| Isoelectric Point | 9.47 |
| Hydrophobicity | -0.65 |
| Melting point | NA |
| Half-life | 4.5 hours (range: 3.3-5.7 hours) |
| Description | Palifermin(140 residues) is a recombinant human keratinocyte growth factor (KGF) produced using E. coli. |
| Indication/Disease | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
| Pharmacodynamics | Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), Kepivance binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. Kepivance acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs. |
| Mechanism of Action | Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Biological Factors, Detoxifying Agents for Antineoplastic Treatment, Fibroblast Growth Factors, Increased Epithelial Proliferation, Intercellular Signaling Peptides and Proteins, Mucocutaneous Epithelial Cell Growth Factor, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | NA |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |