Primary information |
---|
ID | 10217 |
Therapeutic ID | Th1029 |
Protein Name | Menotropins |
Sequence | >Th1029_Menotropins
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
Molecular Weight | 23390.3 |
Chemical Formula | C1014H1609N287O294S27 |
Isoelectric Point | 8.44 |
Hydrophobicity | -0.063 |
Melting point | 55 |
Half-life | NA |
Description | Menotropins contains follicle stimulating hormone and luteinizing hormone purified from the urine of postmenopausal women. It is used as a fertility medication that is injected either subcutaneously or intramuscularly. It is composed of LH with 2 subunit alpha = 92 residues, beta = 121 residues and FSH with 2 subunits, alpha = 92 residues, beta=111 residues. |
Indication/Disease | For the treatment of female infertility |
Pharmacodynamics | Menotropins is used to treat female infertility, stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Menotropins bind to the LH/hCG/FSH receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge. |
Mechanism of Action | Menotropins is a combination drug which binds to the Follicle stimulating hormone receptor (which results in ovulation in the absence of sufficient endogenous Luteinizing hormone)and it also binds to the LH receptor, thereby stimulating proper hormone release. The drug contains both FSH and LH,therefore, it induces ovarian follicular growth and development as well as gonadal steroid production in women who do not have ovarian failure.FSH is the primary driver of follicular recruitment and growth in early folliculogenesis, while LH is important for ovarian steroidogenesis and is involved in the physiological events leading to development of a competent pre-ovulatory follicle. |
Toxicity | NA |
Metabolism | NA |
Absorption | NA |
| NA |
Clearance | NA |
Categories | Amino Acids, Peptides, and Proteins, Biological Products, Complex Mixtures, Fertility Agents, Fertility Agents, Female, Genito Urinary System and Sex Hormones, Gonadotropins, Gonadotropins and Antigonadotropins, Gonadotropins, Pituitary, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Peptide Hormones, Peptides, Pituitary Hormones, Pituitary Hormones, Anterior, Reproductive Control Agents, Sex Hormones and Modulators of the Genital System |
Patents Number | NA |
Date of Issue | NA |
Date of Expiry | NA |
Drug Interaction | Follistim / Antagon (follicle stimulating hormone / ganirelix) |
Target | NA |
Brand Name | NA |
Company | NA |
Brand Description | NA |
Prescribed For | NA |
Chemical Name | NA |
Formulation | NA |
Physical Appearance | NA |
Route of Administration | NA |
Recommended Dosage | NA |
Contraindication | Ovarian cyst or enlargement of undetermined origin, not due to polycystic ovary syndrome |
Side Effects | Headache or drowsiness; weakness or aching of muscles or joints; breast enlargement or tenderness; pain, swelling, or irritation at the injection site; or rash. |
Useful Link 1 | Link |
Useful Link 2 | NA |
Remarks | NA |