| Primary information |
|---|
| ID | 10145 |
| Therapeutic ID | Th1021 |
| Protein Name | Thyrotropin Alfa |
| Sequence | >Th1021_Thyrotropin_Alfa
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| Molecular Weight | 22672.9 |
| Chemical Formula | C975H1513N267O304S26 |
| Isoelectric Point | 7.5 |
| Hydrophobicity | -0.33 |
| Melting point | 55 |
| Half-life | 25 ± 10 hours |
| Description | Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients. |
| Indication/Disease | For detection of residueal or recurrent thyroid cancer |
| Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. |
| Mechanism of Action | Binding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | Time to peak: Median: 10 hours (range: 3-24 hours) After a single intramuscular injection of 0.9 mg of thyrotropin alfa: Cmax= 116+38mU/L, Tmax=22+8.5 hours. AUC=5088+1728 mU·hr/L. |
| NA |
| Clearance | Through kidney and liver |
| Categories | Agents used to treat hypothyroidism, Anterior Pituitary Lobe Hormones and Analogues, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Peptide Hormones, Pituitary and Hypothalamic Hormones and Analogues, Pituitary Hormones, Pituitary Hormones, Anterior, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | US5840566 |
| Date of Issue | 24-Nov-1998 |
| Date of Expiry | 24-Nov-2015 |
| Drug Interaction | NA |
| Target | Thyrotropin receptor |
| Brand Name | Thyrogen |
| Company | Genzyme Corporation , Genzyme Europe Bv |
| Brand Description | Genzyme Corporation , Genzyme Europe Bv |
| Prescribed For | It is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc |
| Chemical Name | NA |
| Formulation | Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride. |
| Physical Appearance | Lyophilized powder |
| Route of Administration | IntramuSubcutaneousular preferably the buttocks |
| Recommended Dosage | A 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later. |
| Contraindication | Allergic |
| Side Effects | Rash; hives; itching; difficulty breathing; tightness in the chest |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |