Detailed description page of ThPDB2

This page displays user query in tabular form.

10145 details
Primary information
ID10145
Therapeutic IDTh1021
Protein NameThyrotropin Alfa
Sequence>Th1021_Thyrotropin_Alfa APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular Weight22672.9
Chemical FormulaC975H1513N267O304S26
Isoelectric Point7.5
Hydrophobicity-0.33
Melting point55
Half-life25 ± 10 hours
DescriptionThyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients.
Indication/DiseaseFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of ActionBinding of thyrotropin Alfa to the thyrotropin receptors found on any residual thyroid cells or tissues stimulates radioactive iodine uptake for better radiodiagnostic imaging.
ToxicityNA
MetabolismNA
AbsorptionTime to peak: Median: 10 hours (range: 3-24 hours) After a single intramuscular injection of 0.9 mg of thyrotropin alfa: Cmax= 116+38mU/L, Tmax=22+8.5 hours. AUC=5088+1728 mU·hr/L.
NA
ClearanceThrough kidney and liver
CategoriesAgents used to treat hypothyroidism, Anterior Pituitary Lobe Hormones and Analogues, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Peptide Hormones, Pituitary and Hypothalamic Hormones and Analogues, Pituitary Hormones, Pituitary Hormones, Anterior, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products
Patents NumberUS5840566
Date of Issue24-Nov-1998
Date of Expiry24-Nov-2015
Drug InteractionNA
TargetThyrotropin receptor
Brand NameThyrogen
CompanyGenzyme Corporation , Genzyme Europe Bv
Brand DescriptionGenzyme Corporation , Genzyme Europe Bv
Prescribed ForIt is used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid canc
Chemical NameNA
FormulationEach vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride.
Physical Appearance Lyophilized powder
Route of AdministrationIntramuSubcutaneousular preferably the buttocks
Recommended DosageA 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later.
ContraindicationAllergic
Side EffectsRash; hives; itching; difficulty breathing; tightness in the chest
Useful Link 1Link
Useful Link 2NA
RemarksNA