| Primary information |
|---|
| ID | 10114 |
| Therapeutic ID | Th1015 |
| Protein Name | Interferon alfa-n3 |
| Sequence | >Th1015_Interferon_alfa-n3
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
|
| Molecular Weight | NA |
| Chemical Formula | NA |
| Isoelectric Point | 5.99 |
| Hydrophobicity | NA |
| Melting point | 61 |
| Half-life | NA |
| Description | Purified, natural human interferon alpha proteins consisting of 3 forms or polymorphisms including 2a, 2b and 2c. It consists of 166 residues(MW range from 16 kD to 27 kD) out of which some are glycosylated. |
| Indication/Disease | For the intralesional treatment of refractory or recurring external condylomata acuminata. |
| Pharmacodynamics | Interferon alfa-n3 upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and make the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R. |
| Mechanism of Action | Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Alfa Interferons, Amino Acids, Peptides, and Proteins, Biological Factors, Cytochrome P-450 CYP1A2 Inhibitors, Cytochrome P-450 CYP1A2 Inhibitors (strength unknown), Cytochrome P-450 Enzyme Inhibitors, Cytokines, Immunosuppressive Agents, Intercellular Signaling Peptides and Proteins, Interferon alpha, Interferon Type I, Interferon-alpha, Interferons, Myelosuppressive Agents, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Alferon N Injection |
| Company | NA |
| Brand Description | NA |
| Prescribed For | Used to treat genital warts (condylomata acuminata) |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | 0.05 mL (250,000 international units) per wart, injected intralesionally twice a week for up to 8 weeks. The maximum recommended dosage per treatment session is 0.5 mL (2.5 million international units). |
| Contraindication | Allergic to to any ingredient in Alferon solution, including egg protein or neomycin |
| Side Effects | Appetite loss; changes in taste or hearing; chills; diarrhea; fatigue; flu-like symptoms; headache; muscle and joint pain; nausea; pain or other reaction at the site of injection; stomach pain; vomiting. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |