Detailed description page of ThPDB2

This page displays user query in tabular form.

10111 details
Primary information
ID10111
Therapeutic IDTh1015
Protein NameInterferon alfa-n3
Sequence>Th1015_Interferon_alfa-n3 CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Molecular WeightNA
Chemical FormulaNA
Isoelectric Point5.99
HydrophobicityNA
Melting point61
Half-lifeNA
DescriptionPurified, natural human interferon alpha proteins consisting of 3 forms or polymorphisms including 2a, 2b and 2c. It consists of 166 residues(MW range from 16 kD to 27 kD) out of which some are glycosylated.
Indication/DiseaseFor the intralesional treatment of refractory or recurring external condylomata acuminata.
PharmacodynamicsInterferon alfa-n3 upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes and make the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
Mechanism of ActionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
ToxicityNA
MetabolismNA
AbsorptionNA
NA
ClearanceNA
CategoriesAlfa Interferons, Amino Acids, Peptides, and Proteins, Biological Factors, Cytochrome P-450 CYP1A2 Inhibitors, Cytochrome P-450 CYP1A2 Inhibitors (strength unknown), Cytochrome P-450 Enzyme Inhibitors, Cytokines, Immunosuppressive Agents, Intercellular Signaling Peptides and Proteins, Interferon alpha, Interferon Type I, Interferon-alpha, Interferons, Myelosuppressive Agents, Peptides, Proteins
Patents NumberNA
Date of IssueNA
Date of ExpiryNA
Drug InteractionNA
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForNA
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsRash; hives; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue; black, tarry stools; bloody diarrhea; chest pain; dark urine or changes in amount of urine; depression; difficulty sleeping; dizziness; drowsiness; intolerance to heat or cold; irregular heartbeat; one-sided weakness (arm, leg); persistent sore throat; poor coordination; pounding in the chest; psychotic or manic behavior; seizures; severe stomach/abdominal pain; suicidal thoughts; tingling hands or feet; unusual bleeding/bruising; unusual increase in thirst; vision changes; vomiting blood; yellowing of the skin or eyes.
Useful Link 1Link
Useful Link 2NA
RemarksNA