| Primary information |
|---|
| ID | 10102 |
| Therapeutic ID | Th1014 |
| Protein Name | Salmon Calcitonin |
| Sequence | >Th1014_Salmon_Calcitonin
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
|
| Molecular Weight | 3431.853 |
| Chemical Formula | C145H240N44O48S2 |
| Isoelectric Point | 8.86 |
| Hydrophobicity | -0.537 |
| Melting point | NA |
| Half-life | 0.83-1.33 hours |
| Description | Synthetic peptide of 32 residues, formulated as a nasal spray. |
| Indication/Disease | Used for the treatment of post-menopausal osteoporosis. |
| Pharmacodynamics | Calcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney. |
| Mechanism of Action | Calcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. |
| Toxicity | It is devoid of embryotoxic, teratogenic and mutagenic potential. |
| Metabolism | Primarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule. |
| Absorption | Rapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively). |
| 0.15 to 0.3 L/kg |
| Clearance | Studies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney. |
| Categories | Amino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | Lithobid (lithium) |
| Target | NA |
| Brand Name | NA |
| Company | NA |
| Brand Description | NA |
| Prescribed For | NA |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | NA |
| Recommended Dosage | NA |
| Contraindication | NA |
| Side Effects | Vomiting; skin rash or itching; increased urination, especially at night; eye pain |
| Useful Link 1 | NA |
| Useful Link 2 | NA |
| Remarks | NA |