Detailed description page of ThPDB2

This page displays user query in tabular form.

10099 details
Primary information
ID10099
Therapeutic IDTh1014
Protein NameSalmon Calcitonin
Sequence>Th1014_Salmon_Calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Molecular Weight3431.853
Chemical FormulaC145H240N44O48S2
Isoelectric Point8.86
Hydrophobicity-0.537
Melting pointNA
Half-life0.83-1.33 hours
DescriptionSynthetic peptide of 32 residues, formulated as a nasal spray.
Indication/DiseaseUsed for the treatment of post-menopausal osteoporosis.
PharmacodynamicsCalcitonin inhibits bone removal by osteoclasts and promotes bone formation by osteoblasts, leading to a net increase in bone mass. Calcitonin also reduces plasma calcium levels and enhances secretion of ions in the kidney.
Mechanism of ActionCalcitonin binds to the calcitonin receptor, found mainly in osteoclasts which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
ToxicityIt is devoid of embryotoxic, teratogenic and mutagenic potential.
MetabolismPrimarily and almost exclusively degraded in the kidneys, forming pharmacologically inactive fragments of the molecule.
AbsorptionRapidly absorbed and eliminated. Bioavailability is high following subcutaneous and intramuscular injection in humans and similar for the two routes of administration (71% and 66%, respectively).
0.15 to 0.3 L/kg
ClearanceStudies with injectable calcitonin show increase in the excretion of filtered calcium, phosphate, and sodium by decreasing their tubular reabsorption in the kidney.
CategoriesAmino Acids, Peptides, and Proteins, Bone Density Conservation Agents, Bone Density, drug effects, Calcitonin Preparations, Calcium Homeostasis, Calcium-Regulating Hormones and Agents, Drugs that are Mainly Renally Excreted, Hormones, Hormones, Hormone Substitutes, and Hormone Antagonists, Nerve Tissue Proteins, Neuropeptides, Parathyroid and Antiparathyroid Agents, Parathyroid Hormones and Analogues, Peptide Hormones, Peptides, Proteins, Systemic Hormonal Preparations, Excl. Sex Hormones and Insulins, Thyroid Products
Patents NumberUS5733569
Date of Issue31-Mar-1998
Date of Expiry31-Mar-2015
Drug InteractionEskalith-CR (lithium)
TargetNA
Brand NameNA
CompanyNA
Brand DescriptionNA
Prescribed ForFor treatment of postmenopausal osteoporosis
Chemical NameNA
FormulationNA
Physical Appearance NA
Route of AdministrationNA
Recommended DosageNA
ContraindicationNA
Side EffectsSwelling in your feet
Useful Link 1Link
Useful Link 2NA
RemarksNA