|
| Primary information |
|---|
| ID | 10095 |
| Therapeutic ID | Th1013 |
| Protein Name | Epoetin alfa |
| Sequence | >Th1013_Epoetin_alfa
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
|
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | NA |
| Melting point | 53 |
| Half-life | NA |
| Description | It is recombinant human erythropoietin which is produced by CHO cells. |
| Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
| Toxicity | Overdose from epoetin alfa include signs and symptoms associated with an excessive and/or rapid increase in hemoglobin concentration, including cardiovascular events. Patients with suspected or known overdose should be monitored closely for cardiovascular events and hematologic abnormalities. |
| Metabolism | Binding of erythropoietin and epoetin alfa to EPO-R leads to cellular internalization, which involves the degradation of the ligand. Erythropoietin and epoetin alfa may also be degraded by the reticuloendothelial scavenging pathway or lymphatic system |
| Absorption | Bioavailability is 20-40% |
| 40–63.80 mL/kg |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antianemic Preparations, Biological Factors, Blood and Blood Forming Organs, Colony-Stimulating Factors, Cytokines, Erythropoiesis-Stimulating Agents, Erythropoietin, genetics, Glycoproteins, Hematinics, Hematologic Agents, Hematopoietic Cell Growth Factors, Increased Erythroid Cell Production, Intercellular Signaling Peptides and Proteins, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Procrit |
| Company | Ortho Biotech |
| Brand Description | Ortho Biotech |
| Prescribed For | Used to treat anemia in patients with Chronic Kidney Disease (CKD). Procrit is also used to treat anemia caused by zidovudine in HIV-infected patients and in certain patients receiving chemotherapy. |
| Chemical Name | NA |
| Formulation | Each 1 mL of solution contains 2000, 3000, 4000 or 10,000 Units of Epoetin alfa, 2.5 mg Albumin (Human), 5.8 mg sodium citrate, 5.8 mg sodium chloride, and 0.06 mg citric acid in Water for Injection, USP (pH 6.9 ± 0.3). This formulation contains no preser |
| Physical Appearance | Sterile, colorless liquid in an isotonic sodium chloride/sodium citrate buffered solution or a sodium chloride/sodium phosphate buffered solution |
| Route of Administration | Intravenous (Intravenous) or Subcutaneous (Subcuta |
| Recommended Dosage | 100 units/kg subcutaneously or IV 3 times a week. |
| Contraindication | Allergic |
| Side Effects | Feeling light-headed, fainting, fever, chills, body aches, flu symptoms, sores in your mouth and throat, pale skin, feeling short of breath, rapid heart rate, trouble concentrating, easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |