|
| Primary information |
|---|
| ID | 10082 |
| Therapeutic ID | Th1013 |
| Protein Name | Epoetin alfa |
| Sequence | >Th1013_Epoetin_alfa
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
|
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | NA |
| Melting point | 53 |
| Half-life | NA |
| Description | It is recombinant human erythropoietin which is produced by CHO cells. |
| Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
| Toxicity | Overdose from epoetin alfa include signs and symptoms associated with an excessive and/or rapid increase in hemoglobin concentration, including cardiovascular events. Patients with suspected or known overdose should be monitored closely for cardiovascular events and hematologic abnormalities. |
| Metabolism | Binding of erythropoietin and epoetin alfa to EPO-R leads to cellular internalization, which involves the degradation of the ligand. Erythropoietin and epoetin alfa may also be degraded by the reticuloendothelial scavenging pathway or lymphatic system |
| Absorption | Bioavailability is 20-40% |
| 40–63.80 mL/kg |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antianemic Preparations, Biological Factors, Blood and Blood Forming Organs, Colony-Stimulating Factors, Cytokines, Erythropoiesis-Stimulating Agents, Erythropoietin, genetics, Glycoproteins, Hematinics, Hematologic Agents, Hematopoietic Cell Growth Factors, Increased Erythroid Cell Production, Intercellular Signaling Peptides and Proteins, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Eprex |
| Company | Janssen-Cilag. Ortho Biologics LLC |
| Brand Description | Janssen-Cilag. Ortho Biologics LLC |
| Prescribed For | To treat patients with symptomatic or transfusion requiring anaemia associated with chronic renal failure to improve their quality of life. |
| Chemical Name | NA |
| Formulation | Each mL of sterile solution contains epoetin alfa 1,000 IU, 2,000 IU, 4,000 IU, 10,000 IU, or 40,000 IU. Nonmedicinal ingredients include glycine and polysorbate 80 as stabilizers, sodium chloride, sodium phosphate dibasic dihydrate, sodium phosphate mono |
| Physical Appearance | Solution |
| Route of Administration | Subcutaneous and Intravenous infusion |
| Recommended Dosage | For children with chronic renal failure, the starting dose for anemia is 50 units (IU) per kilogram body weight, given 3 times a week. For adults with chronic renal failure, the starting dose for anemia is 50 to 100 units per kilogram of body weight. |
| Contraindication | Uncontrolled hypertension |
| Side Effects | Clotting of the vascular access site (for people on hemodialysis), dehydration, diarrhea, edema (swelling of the face, fingers, ankles, feet, or lower legs), headache, increased or decreased blood pressure, dizziness, or feeling faint, muscle aches and weakness. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |