| Primary information |
|---|
| ID | 10079 |
| Therapeutic ID | Th1013 |
| Protein Name | Epoetin alfa |
| Sequence | >Th1013_Epoetin_alfa
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
|
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | NA |
| Melting point | 53 |
| Half-life | NA |
| Description | It is recombinant human erythropoietin which is produced by CHO cells. |
| Indication/Disease | For treatment of anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Used in the treatment of anemia and involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation. |
| Toxicity | Overdose from epoetin alfa include signs and symptoms associated with an excessive and/or rapid increase in hemoglobin concentration, including cardiovascular events. Patients with suspected or known overdose should be monitored closely for cardiovascular events and hematologic abnormalities. |
| Metabolism | Binding of erythropoietin and epoetin alfa to EPO-R leads to cellular internalization, which involves the degradation of the ligand. Erythropoietin and epoetin alfa may also be degraded by the reticuloendothelial scavenging pathway or lymphatic system |
| Absorption | Bioavailability is 20-40% |
| 40–63.80 mL/kg |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antianemic Preparations, Biological Factors, Blood and Blood Forming Organs, Colony-Stimulating Factors, Cytokines, Erythropoiesis-Stimulating Agents, Erythropoietin, genetics, Glycoproteins, Hematinics, Hematologic Agents, Hematopoietic Cell Growth Factors, Increased Erythroid Cell Production, Intercellular Signaling Peptides and Proteins, Peptides, Proteins |
| Patents Number | NA |
| Date of Issue | NA |
| Date of Expiry | NA |
| Drug Interaction | NA |
| Target | NA |
| Brand Name | Epogin |
| Company | Chugai |
| Brand Description | Chugai |
| Prescribed For | EPOGIN Injection (EPOGIN Injection Syringe, EPOGIN Injection Ampule) has been widely used in the clinical settings for its approved indications of renal anemia under dialysis and before dialysis, immature infant anemia, and the autologous blood transfusio |
| Chemical Name | NA |
| Formulation | NA |
| Physical Appearance | NA |
| Route of Administration | Subcutaneous and Intravenous infusion |
| Recommended Dosage | The autologous blood transfusion, the intravenous administration of Epogin at 6000 units/per time for three times a week on alternative days has been already approved for three forms of “Epogin Injection 1500, 3000 and 6000. |
| Contraindication | NA |
| Side Effects | Nausea, fatigue, and vomiting. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |