| Primary information |
|---|
| ID | 10064 |
| Therapeutic ID | Th1011 |
| Protein Name | Darbepoetin alfa |
| Sequence | >Th1011_Darbepoetin_alfa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCNETCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQVNETLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
|
| Molecular Weight | 18396.1 |
| Chemical Formula | C815H1317N233O241S5 |
| Isoelectric Point | 8.75 |
| Hydrophobicity | -0.188 |
| Melting point | 53 |
| Half-life | NA |
| Description | Human erythropoietin with 2 amino acid substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW 37kD) produced in CHO cells by recombinant DNA technology. |
| Indication/Disease | For treating anemia (from renal transplants or certain HIV treatment). |
| Pharmacodynamics | Darbepoetin alfa is used in treating anemia. It is involved in the regulation of erythrocyte differentiation and maintenance of a physiological level of circulating erythrocyte mass. |
| Mechanism of Action | Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin, it interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization. |
| Toxicity | NA |
| Metabolism | NA |
| Absorption | NA |
| NA |
| Clearance | NA |
| Categories | Amino Acids, Peptides, and Proteins, Antianemic Preparations, Blood and Blood Forming Organs, Colony-Stimulating Factors, Erythropoiesis-Stimulating Agents, Glycoproteins, Hematinics, Hematologic Agents, Hematopoietic Cell Growth Factors, Increased Erythroid Cell Production, Proteins |
| Patents Number | CA2165694 |
| Date of Issue | 18-Mar-2003 |
| Date of Expiry | 15-Oct-2010 |
| Drug Interaction | NA |
| Target | Erythropoietin receptor |
| Brand Name | Aranesp |
| Company | Amgen Inc |
| Brand Description | Amgen Inc |
| Prescribed For | Used to treat anemia. |
| Chemical Name | NA |
| Formulation | Each 1 mL contains polysorbate 80 (0.05 mg), sodium chloride (8.18 mg), sodium phosphate dibasic anhydrous (0.66 mg), and sodium phosphate monobasic monohydrate (2.12 mg) in Water for Injection, USP (pH 6.2 ± 0.2). |
| Physical Appearance | Sterile, colorless, preservative-free solution containing polysorbate |
| Route of Administration | Intravenous or Subcutaneous administration |
| Recommended Dosage | NA |
| Contraindication | Allergic |
| Side Effects | Fever, chills, body aches, flu symptoms; feeling like you might pass out; easy bruising, unusual bleeding (nose, mouth, vagina, or rectum), purple or red pinpoint spots under your skin; seizure (black-out or convulsions); or dangerously high blood pressure. |
| Useful Link 1 | Link |
| Useful Link 2 | NA |
| Remarks | NA |