This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb18802. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb18802 |
| Sequence | FKIKPGKVLDKFGKIVGKVLKQLKKVSAVAKV |
| C-terminal modification | Amidation |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 1 (parapep) |
| Link to Source | parapep_1131, |
| Major Functions | 3 (antiparasitic, toxic, antimicrobial,) |
| Sub-functions | cytotoxic, antitrypanosomic |
| Additional Info | NA, |
| Helix (%) | 84.4 |
| Strand (%) | 0 |
| Coil (%) | 15.6 |
| Turn (%) | 0 |
| DSSP states | CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC |
| Tertiary Structure (Technique) | View in Jmol  OR Download Structure (I-TASSER) |