This page display detail information about a peptide. Following is detail description of peptide having ID: satpdb16826. One may get more information on these peptides by clicking on source of information (Link to Source). This page also allow to visulaize or download tertiary structure of this peptide.
| Field/Function | Detailed desription |
|---|---|
| Peptide ID | satpdb16826 |
| Sequence | GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR |
| C-terminal modification | Free |
| N-terminal modification | Free |
| Peptide Type | Linear |
| Type of Modification | None |
| Source (Databases) | 4 (apd2, hemolytik, parapep, yadamp) |
| Link to Source | apd2_AP00285, hemolytik_2977, hemolytik_2978, hemolytik_2979, hemolytik_2980, hemolytik_2981, parapep_1294, yadamp_1305, |
| Major Functions | 4 (antibacterial, antiparasitic, toxic, antimicrobial,) |
| Sub-functions | hemolytic, anti-gram+, antitrypanosomic, anti-gram- |
| Additional Info | NA, |
| Helix (%) | 0 |
| Strand (%) | 31.2 |
| Coil (%) | 40.6 |
| Turn (%) | 28.1 |
| DSSP states | CCCCEEEESCCSSCEECSSCSSSSEEEECCCC |
| Tertiary Structure (Technique) | View in Jmol OR Download Structure (Experimentally determined structure from PDB) |