Primary information |
---|
PRRID | PRRID_0084 |
Ligand Name | Ax21 |
Source | Xanthomonas oryzae oryzae (plant) |
Sequence of ligand | MLALGLLAALPFAASAAENLSYNFVEGDYVRTPTDGRDADGWGVKASYAVAPNFHVFGEYSKQNADDNNNLFENTNFDFQQWGVGVGFNHEIATSTDFVARVAYRRLDLDSPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDYSKKRGIDAGNDFYGRLGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW |
Length | 194 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It triggered the PAMP mediated immunity |
Name of receptor | XA21 |
Type of receptor | PRR |
Source | Rice |
Localization | NA |
Domain | NA |
Sequence of Receptor | Q1MX30.fasta |
Swiss prot ID | Q1MX30 |
Length Of Receptor | 1025 |
Function | It provides the immunity to the plant against the pathogen by recognizing the PAMP |
Assay used | NA |
PMID | 20713980 |
Year of Publication | 2010 |
Pubchem assay | NA |
Pdb | PRR_0084.pdb |
3-D Structure | PRR_0084 (View) or (Download) |