Primary information |
---|
PRRID | PRRID_0073 |
Ligand Name | TgPRF (T. gondii profilin-like protein) |
Source | T. gondii (others) |
Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
Length | 165 |
Type | Protein |
Occurence | Natural |
Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
Name of receptor | TLR11 |
Type of receptor | TLR |
Source | Swiss albino mice brain |
Localization | microglia/macrophages, astrocytes, and neurons |
Domain | NA |
Sequence of Receptor | Q6R5P0.fasta |
Swiss prot ID | Q6R5P0 |
Length Of Receptor | 926 |
Function | TLR11 activation is unique in its ability to initiate a parasite-specific innate immune response. TLR11 is unusual in its recognition of T. gondii, because it senses the pathogen by recognizing a profilin released by the microbe rather than by directly interacting with the live parasite |
Assay used | Double-labeling immunohistochemistry, Real-time quantitative polymerase chain reaction (PCR) |
PMID | 24704432 |
Year of Publication | 2014 |
Pubchem assay | NA |
Pdb | PRR_0073.pdb |
3-D Structure | PRR_0073 (View) or (Download) |