Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_2192 details |
Primary information | |
---|---|
PRRID | PRRID_2192 |
Ligand Name | HMGB1 |
Source | NA |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | Rat |
Localization | rat hippocampus (microglia) |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q6YGU2.fasta |
Swiss prot ID | Q6YGU2 |
Length Of Receptor | 784 |
Function | mRNA ‚Üë in postoperative cognitive dysfunction in senile animals |
Assay used | NA |
PMID | 28801521 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |
Primary information | |
---|---|
PRRID | PRRID_2192 |
Ligand Name | HMGB1 |
Source | NA |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | NA |
Name of receptor | Toll-like receptor 2 (TLR2) |
Type of receptor | Toll-like receptor (TLR) |
Source | Rat |
Localization | rat hippocampus (microglia) |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q6YGU2.fasta |
Swiss prot ID | Q6YGU2 |
Length Of Receptor | 784 |
Function | mRNA ‚Üë in postoperative cognitive dysfunction in senile animals |
Assay used | NA |
PMID | 28801521 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |