| Primary information |
|---|
| PRRID | PRRID_2167 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | an autocine trophic factor in ischemic ol death and white matter injury |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | white matter |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | executors for post-ischemic inflammation after interaction with danger associated molecular pattern protein (DAMP) |
| Assay used | NA |
| PMID | 28912641 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_2167 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | an autocine trophic factor in ischemic ol death and white matter injury |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | white matter |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O60603.fasta |
| Swiss prot ID | O60603 |
| Length Of Receptor | 784 |
| Function | executors for post-ischemic inflammation after interaction with danger associated molecular pattern protein (DAMP) |
| Assay used | NA |
| PMID | 28912641 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |