Primary information |
---|
PRRID | PRRID_2166 |
Ligand Name | HMGB1 |
Source | Host (Endogenous) (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | translocates to the cytoplasm and extracellular space during cell activation and death |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | gastric epithelial cells |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | NA |
Assay used | NA |
PMID | 29146293 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_2166 |
Ligand Name | HMGB1 |
Source | Host (Endogenous) (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | translocates to the cytoplasm and extracellular space during cell activation and death |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | gastric epithelial cells |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | NA |
Assay used | NA |
PMID | 29146293 |
Year of Publication | 2017 |
Pubchem assay | Pubchem_assay |