| Primary information |
|---|
| PRRID | PRRID_2166 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | translocates to the cytoplasm and extracellular space during cell activation and death |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | gastric epithelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | NA |
| Assay used | NA |
| PMID | 29146293 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_2166 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | translocates to the cytoplasm and extracellular space during cell activation and death |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | gastric epithelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | NA |
| Assay used | NA |
| PMID | 29146293 |
| Year of Publication | 2017 |
| Pubchem assay | Pubchem_assay |