Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_2165 details |
| Primary information | |
|---|---|
| PRRID | PRRID_2165 |
| Ligand Name | HMGB1 |
| Source | nucleus, autophagosome (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | NA |
| Localization | NA |
| Domain | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | NA |
| Assay used | NA |
| PMID | 29290139 |
| Year of Publication | 2017 |
| Pubchem assay | NA |
| Primary information | |
|---|---|
| PRRID | PRRID_2165 |
| Ligand Name | HMGB1 |
| Source | nucleus, autophagosome (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | NA |
| Localization | NA |
| Domain | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | NA |
| Assay used | NA |
| PMID | 29290139 |
| Year of Publication | 2017 |
| Pubchem assay | NA |