Primary information |
---|
PRRID | PRRID_2165 |
Ligand Name | HMGB1 |
Source | nucleus, autophagosome (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | NA |
Localization | NA |
Domain | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | NA |
Assay used | NA |
PMID | 29290139 |
Year of Publication | 2017 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_2165 |
Ligand Name | HMGB1 |
Source | nucleus, autophagosome (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | involved in the resolution and fine-tuning of inflammation by orchestrating the production of anti-inflammatory mediators that are required for the resolution of tissue inflammation and the transition to acquired immunity |
Name of receptor | RAGE |
Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
Source | NA |
Localization | NA |
Domain | extracellular domain formed by three immunoglobulin domains (V-C1-C2), a single transmembrane domain and cytosolic portions. |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | NA |
Assay used | NA |
PMID | 29290139 |
Year of Publication | 2017 |
Pubchem assay | NA |