| Primary information |
|---|
| PRRID | PRRID_1649 |
| Ligand Name | TgPRF (T. gondii profilin-like protein) |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Swiss albino mice brain |
| Localization | microglia/macrophages, astrocytes, and neurons |
| Domain | NA |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function | TLR11 activation is unique in its ability to initiate a parasite-specific innate immune response. TLR11 is unusual in its recognition of T. gondii, because it senses the pathogen by recognizing a profilin released by the microbe rather than by directly interacting with the live parasite |
| Assay used | Double-labeling immunohistochemistry, Real-time quantitative polymerase chain reaction (PCR) |
| PMID | 24704432 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1649 |
| Ligand Name | TgPRF (T. gondii profilin-like protein) |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | potently activate the innate immune system through its specific recognition by TLR11, which plays an important role in T. gondii infection in mice |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Swiss albino mice brain |
| Localization | microglia/macrophages, astrocytes, and neurons |
| Domain | NA |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function | TLR11 activation is unique in its ability to initiate a parasite-specific innate immune response. TLR11 is unusual in its recognition of T. gondii, because it senses the pathogen by recognizing a profilin released by the microbe rather than by directly interacting with the live parasite |
| Assay used | Double-labeling immunohistochemistry, Real-time quantitative polymerase chain reaction (PCR) |
| PMID | 24704432 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |