| Primary information |
|---|
| PRRID | PRRID_1609 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | (DCs)Dendritic cells |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | NA |
| PMID | 24825061 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1609 |
| Ligand Name | S100 proteins |
| Source | NA |
| Sequence of ligand | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Length | 92 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | elicit innate immune response |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | (DCs)Dendritic cells |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | NA |
| PMID | 24825061 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |