Primary information |
---|
PRRID | PRRID_1603 |
Ligand Name | resistin (RSTN)] |
Source | Primates, rodents (others) |
Sequence of ligand | MKNLSFPLLFLFFLVPELLGSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
Length | 114 |
Type | Pattern-associated molecular patterns (PAMPs) |
Occurence | Natural |
Role of Ligand | associated with atherosclerosis. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24823872 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1603 |
Ligand Name | resistin (RSTN)] |
Source | Primates, rodents (others) |
Sequence of ligand | MKNLSFPLLFLFFLVPELLGSSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
Length | 114 |
Type | Pattern-associated molecular patterns (PAMPs) |
Occurence | Natural |
Role of Ligand | associated with atherosclerosis. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24823872 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |