Primary information |
---|
PRRID | PRRID_1561 |
Ligand Name | peroxiredoxins |
Source | NA |
Sequence of ligand | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Length | 199 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | released in brain injury |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | ischemic brain tissue |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | TLR4 signaling has been implicated in post-stroke neuroinflammation and injury and is also critical in the robustly neuroprotective ischemic preconditioning phenomenon |
Assay used | NA |
PMID | 24784586 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1561 |
Ligand Name | peroxiredoxins |
Source | NA |
Sequence of ligand | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Length | 199 |
Type | Damage-associated molecular patterns (DAMPs) |
Occurence | Natural |
Role of Ligand | released in brain injury |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | ischemic brain tissue |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | TLR4 signaling has been implicated in post-stroke neuroinflammation and injury and is also critical in the robustly neuroprotective ischemic preconditioning phenomenon |
Assay used | NA |
PMID | 24784586 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |